NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS15668.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
15668.1 Public Mus musculus 2 Sec61a2 21 106 86 CCDS HistoryNCBI Gene:57743Re-query CCDS DB by CCDS ID:15668.1Re-query CCDS DB by GeneID:57743See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 15668.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000102981 ENSMUSP00000100046 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000102981Link to Ensembl Protein Viewer:ENSMUSP00000100046Re-query CCDS DB by Nucleotide ID:ENSMUST00000102981Re-query CCDS DB by Protein ID:ENSMUSP00000100046
Original member Current member EBI,WTSI OTTMUST00000025464 OTTMUSP00000011664 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000025464Link to Vega Protein Viewer:OTTMUSP00000011664Re-query CCDS DB by Nucleotide ID:OTTMUST00000025464Re-query CCDS DB by Protein ID:OTTMUSP00000011664
Original member NCBI NM_021305.3 NP_067280.1 Updated not alive Link to Nucleotide Sequence:NM_021305.3Link to Protein Sequence:NP_067280.1Re-query CCDS DB by Nucleotide ID:NM_021305Re-query CCDS DB by Protein ID:NP_067280
Current member NCBI NM_021305.4 NP_067280.1 Accepted alive Link to Nucleotide Sequence:NM_021305.4Link to Protein Sequence:NP_067280.1Re-query CCDS DB by Nucleotide ID:NM_021305Re-query CCDS DB by Protein ID:NP_067280Link to BLAST:NP_067280.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_067280.1 476 Q9JLR1 476 100% 0 0

Chromosomal Locations for CCDS 15668.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 5871835 5872021 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 5873743 5873819 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 5874227 5874418 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 5876364 5876561 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 5876841 5877001 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 5877855 5878008 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 5882581 5882690 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 5882818 5882949 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 5886499 5886577 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 5891290 5891355 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 5893154 5893221 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 5895257 5895263 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1431 nt):
ATGGGCATCAAGTTTTTAGAAGTTATTAAACCTTTCTGTGCAGTTCTACCAGAAATTCAGAAGCCTGAAA
GG
AAAATTCAGTTTAGAGAGAAGGTACTATGGACTGCTATAACACTCTTCATTTTCTTAGTATGCTGTCA
G
ATTCCGCTGTTTGGGATCATGTCATCGGACTCTGCAGATCCCTTCTACTGGATGAGAGTTATTCTTGCA
TCC
AACAGAGGAACATTGATGGAATTGGGTATTTCCCCAATTGTAACGTCTGGTTTGATTATGCAGTTGT
TA
GCTGGAGCCAAAATCATTGAAGTTGGAGACACACCCAAAGATAGAGCTCTGTTCAATGGAGCCCAGAA
A
TTATTTGGTATGATCATTACCATTGGGCAAGCCATTGTGTATGTCATGACGGGGATGTACGGGGACCCT
GCG
GAAATGGGTGCTGGGATCTGTCTCCTTATCATTATTCAGTTGTTTGTTGCTGGTTTGATTGTGCTGC
TG
TTAGATGAGCTGCTACAGAAGGGTTACGGCTTGGGGTCTGGGATTTCCCTCTTTATTGCCACCAACAT
C
TGTGAAACCATTGTCTGGAAGGCCTTTAGTCCCACTACCATTAACACTGGCAGAGGTACGGAGTTTGAA
GGT
GCAGTCATAGCTCTGTTTCATTTGCTGGCCACCAGGACAGACAAGGTGCGAGCCTTGAGGGAGGCTT
TC
TATAGGCAGAACCTCCCCAACCTCATGAACCTCATCGCCACAGTGTTCGTGTTTGCTGTCGTCATCTA
T
TTTCAGGGGTTTCGTGTTGACTTGCCCATTAAGTCGGCACGGTATCGTGGACAGTACAGTAGCTATCCT
ATC
AAGCTCTTCTACACGTCGAATATTCCCATAATCCTCCAGTCTGCCCTAGTTTCAAACTTGTACGTCA
TT
TCCCAGATGCTGTCTGTTCGATTTAGTGGCAACTTCTTAGTAAACTTACTAGGACAGTGGGCCGATGT
C
AGTGGGGGAGGGCCTGCTCGCTCCTACCCTGTTGGCGGCCTTTGTTACTATCTGTCTCCTCCTGAGTCT
ATG
GGAGCCATATTTGAGGATCCTGTTCATGTAGTTGTATATATTATCTTCATGTTGGGGTCATGTGCAT
TC
TTTTCTAAGACGTGGATAGAAGTTTCTGGTTCTTCAGCCAAAGATGTGGCCAAGCAACTTAAAGAACA
G
CAGATGGTGATGAGGGGTCACAGAGATACCTCCATGGTCCATGAGCTGAACAGGTACATCCCCACAGCA
GCT
GCCTTTGGGGGTCTGTGCATCGGTGCCCTGTCAGTACTAGCAGACTTCCTTGGGGCCATTGGCTCTG
GT
ACTGGAATTCTGCTTGCAGTCACTATTATTTATCAGTATTTTGAAATATTTGTTAAGGAACAGGCTGA
A
GTTGGTGGAATGGGTGCTTTGTTTTTCTAA


Translation (476 aa):
MGIKFLEVIKPFCAVLPEIQKPERKIQFREKVLWTAITLFIFLVCCQIPLFGIMSSDSADPFYWMRVILA
S
NR
GTLMELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFGMIITIGQAIVYVMTGMYGDP
A
EMGAGICLLIIIQ
LFVAGLIVLLLDELLQKGYGLGSGISLFIATNICETIVWKAFSPTTINTGRGTEFE
G
AVIALFHLLATRTDKVRALREAFYRQNLPNLMNLIATVFVFAVVIYFQ
GFRVDLPIKSARYRGQYSSYP
I
KLFYTSNIPIILQSALVSNLYVISQMLSVRFSGNFLVNLLGQWA
DVSGGGPARSYPVGGLCYYLSPPES
M
GAIFEDPVHVVVYIIFMLGSCAFFSKTWIEVSGSSAKD
VAKQLKEQQMVMRGHRDTSMVHELNRYIPTA
A
AFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQAEVGGMGALFF




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser