NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS1558.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
1558.1 Public Homo sapiens 1 CDC42BPA 22 109 92 CCDS HistoryNCBI Gene:8476Re-query CCDS DB by CCDS ID:1558.1Re-query CCDS DB by GeneID:8476See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 1558.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000366769.7 ENSP00000355731.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000366769.7Link to Ensembl Protein Viewer:ENSP00000355731.3Re-query CCDS DB by Nucleotide ID:ENST00000366769Re-query CCDS DB by Protein ID:ENSP00000355731
Original member Current member NCBI NM_003607.3 NP_003598.2 Accepted alive Link to Nucleotide Sequence:NM_003607.3Link to Protein Sequence:NP_003598.2Re-query CCDS DB by Nucleotide ID:NM_003607Re-query CCDS DB by Protein ID:NP_003598Link to BLAST:NP_003598.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_003598.2 1719 Q5VT25-5 1719 100% 0 0

Chromosomal Locations for CCDS 1558.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 1 (NC_000001.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 226994268 226994399 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 226994823 226994980 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 227004994 227005111 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 227016080 227016197 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 227016927 227017050 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 227023263 227023347 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 227026055 227026152 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 227028657 227029250 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 227030408 227030470 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 227031298 227031514 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 227033334 227033415 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 227034655 227034794 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 227035471 227035607 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 227040131 227040236 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 227047927 227048010 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 227069777 227069853 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 227072208 227072299 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 227073864 227074012 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 227074259 227074364 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 227080893 227081017 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 227091886 227091991 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 227100992 227101239 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 227112312 227112422 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 227112671 227112913 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 227119804 227119937 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 227129109 227129231 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 227139576 227139742 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 227142945 227143024 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 227145489 227145737 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 227147359 227147559 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 227160543 227160636 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 227193786 227193934 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 227199557 227199652 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 227213136 227213219 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 227254064 227254155 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 227317005 227317182 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (5160 nt):
ATGTCTGGAGAAGTGCGTTTGAGGCAGTTGGAGCAGTTTATTTTGGACGGGCCCGCTCAGACCAATGGGC
AG
TGCTTCAGTGTGGAGACATTACTGGATATACTCATCTGCCTTTATGATGAATGCAATAATTCTCCATT
G
AGAAGAGAGAAGAACATTCTCGAATACCTAGAATGGGCTAAACCATTTACTTCTAAAGTGAAACAAATG
CGA
TTACATAGAGAAGACTTTGAAATATTAAAGGTGATTGGTCGAGGAGCTTTTGGGGAGGTTGCTGTAG
TA
AAACTAAAAAATGCAGATAAAGTGTTTGCCATGAAAATATTGAATAAATGGGAAATGCTGAAAAGAGC
T
GAGACAGCATGTTTTCGTGAAGAAAGGGATGTATTAGTGAATGGAGACAATAAATGGATTACAACCTTG
CAC
TATGCTTTCCAGGATGACAATAACTTATACCTGGTTATGGATTATTATGTTGGTGGGGATTTGCTTA
CT
CTACTCAGCAAATTTGAAGATAGATTGCCTGAAGATATGGCTAGATTTTACTTGGCTGAGATGGTGAT
A
GCAATTGACTCAGTTCATCAGCTACATTATGTACACAGAGACATTAAACCTGACAATATACTGATGGAT
ATG
AATGGACATATTCGGTTAGCAGATTTTGGTTCTTGTCTGAAGCTGATGGAAGATGGAACGGTTCAGT
CC
TCAGTGGCTGTAGGAACTCCAGATTATATCTCTCCTGAAATCCTTCAAGCCATGGAAGATGGAAAAGG
G
AGATATGGACCTGAATGTGACTGGTGGTCTTTGGGGGTCTGTATGTATGAAATGCTTTACGGAGAAACA
CCA
TTTTATGCAGAATCGCTGGTGGAGACATACGGAAAAATCATGAACCACAAAGAGAGGTTTCAGTTTC
CA
GCCCAAGTGACTGATGTGTCTGAAAATGCTAAGGATCTTATTCGAAGGCTCATTTGTAGCAGAGAACA
T
CGACTTGGTCAAAATGGAATAGAAGACTTTAAGAAACACCCATTTTTCAGTGGAATTGATTGGGATAAT
ATT
CGGAACTGTGAAGCACCTTATATTCCAGAAGTTAGTAGCCCAACAGATACATCGAATTTTGATGTAG
AT
GATGATTGTTTAAAAAATTCTGAAACGATGCCCCCACCAACACATACTGCATTTTCTGGCCACCATCT
G
CCATTTGTTGGTTTTACATATACTAGTAGCTGTGTACTTTCTGATCGGAGCTGTTTAAGAGTTACGGCT
GGT
CCCACCTCACTGGATCTTGATGTTAATGTTCAGAGGACTCTAGACAACAACTTAGCAACTGAAGCTT
AT
GAAAGAAGAATTAAGCGCCTTGAGCAAGAAAAACTTGAACTCAGTAGAAAACTTCAAGAGTCAACACA
G
ACTGTCCAAGCTCTGCAGTATTCAACTGTTGATGGTCCACTAACAGCAAGCAAAGATTTAGAAATAAAA
AAC
TTAAAAGAAGAAATTGAAAAACTAAGAAAACAAGTAACAGAATCAAGTCATTTGGAACAGCAACTTG
AA
GAAGCTAATGCTGTGAGGCAAGAACTAGATGATGCTTTTAGACAAATCAAGGCTTATGAAAAACAAAT
C
AAAACGTTACAACAAGAAAGAGAAGATCTAAATAAGGAACTAGTCCAGGCTAGTGAGCGATTAAAAAAC
CAA
TCCAAAGAGCTGAAAGACGCACACTGTCAGAGGAAACTGGCCATGCAGGAATTCATGGAGATCAATG
AG
CGGCTAACAGAATTGCACACCCAAAAACAGAAACTTGCTCGCCATGTCCGAGATAAGGAAGAAGAGGT
G
GACCTGGTGATGCAAAAAGTTGAAAGCTTAAGGCAAGAACTGCGCAGAACAGAAAGAGCCAAAAAAGAG
CTG
GAAGTTCATACAGAAGCTCTAGCTGCTGAAGCATCTAAAGACAGGAAGCTACGTGAACAGAGTGAGC
AC
TATTCTAAGCAACTGGAAAATGAATTGGAGGGACTGAAGCAAAAACAAATTAGTTACTCACCAGGAGT
A
TGCAGCATAGAACATCAGCAAGAGATAACCAAACTAAAGACTGATTTGGAAAAGAAAAGTATCTTTTAT
GAA
GAAGAATTATCTAAAAGAGAAGGAATACATGCAAATGAAATAAAAAATCTTAAGAAAGAACTGCATG
AT
TCAGAAGGTCAGCAACTTGCTCTCAACAAAGAAATTATGATTTTAAAAGACAAATTGGAAAAAACCAG
A
AGAGAAAGTCAAAGTGAAAGGGAGGAATTTGAAAGTGAGTTCAAACAACAATATGAACGAGAAAAAGTG
TTG
TTAACTGAAGAAAATAAAAAGCTGACGAGTGAACTTGATAAGCTTACTACTTTGTATGAGAACTTAA
GT
ATACACAACCAGCAGTTAGAAGAAGAGGTTAAAGATCTAGCAGACAAGAAAGAATCAGTTGCACATTG
G
GAAGCCCAAATCACAGAAATAATTCAGTGGGTCAGCGATGAAAAGGATGCACGAGGGTATCTTCAGGCC
TTA
GCTTCTAAAATGACTGAAGAATTGGAGGCATTAAGAAATTCCAGCTTGGGTACACGAGCAACAGATA
TG
CCCTGGAAAATGCGTCGTTTTGCGAAACTGGATATGTCAGCTAGACTGGAGTTGCAGTCGGCTCTGGA
T
GCAGAAATAAGAGCCAAACAGGCCATCCAAGAAGAGTTGAATAAAGTTAAAGCATCTAATATCATAACA
GAA
TGTAAACTAAAAGATTCAGAGAAGAAGAACTTGGAACTACTCTCAGAAATCGAACAGCTGATAAAGG
AC
ACTGAAGAGCTTAGATCTGAAAAGGGTATAGAGCACCAAGACTCACAGCATTCTTTCTTGGCATTTTT
G
AATACGCCTACCGATGCTCTGGATCAATTTGAAACTGTAGACTCCACTCCACTTTCAGTTCACACACCA
ACC
TTAAGGAAAAAAGGATGTCCTGGTTCAACTGGCTTTCCACCTAAGCGCAAGACTCACCAGTTTTTTG
TA
AAATCTTTTACTACTCCTACCAAGTGTCATCAGTGTACCTCCTTGATGGTGGGTTTAATAAGACAGGG
C
TGTTCATGTGAAGTGTGTGGATTCTCATGCCATATAACTTGTGTAAACAAAGCTCCAACCACTTGTCCA
GTT
CCTCCTGAACAGACAAAAGGTCCCCTGGGTATAGATCCTCAGAAAGGAATAGGAACAGCATATGAAG
GT
CATGTCAGGATTCCTAAGCCAGCTGGAGTGAAGAAAGGGTGGCAGAGAGCACTGGCTATAGTGTGTGA
C
TTCAAACTCTTTCTGTACGATATTGCTGAAGGAAAAGCATCTCAGCCCAGTGTTGTCATTAGTCAAGTG
ATT
GACATGAGGGATGAAGAATTTTCTGTGAGTTCAGTCTTGGCTTCTGATGTTATCCATGCAAGTCGGA
AA
GATATACCCTGTATATTTAGGGTCACAGCTTCCCAGCTCTCAGCATCTAATAACAAATGTTCAATCCT
G
ATGCTAGCAGACACTGAGAATGAGAAGAATAAGTGGGTGGGAGTGCTGAGTGAATTGCACAAGATTTTG
AAG
AAAAACAAATTCAGAGACCGCTCAGTCTATGTTCCCAAAGAGGCTTATGACAGCACTCTACCCCTCA
TT
AAAACAACCCAGGCAGCCGCAATCATAGATCATGAAAGAATTGCTTTGGGAAACGAAGAAGGGTTATT
T
GTTGTACATGTCACCAAAGATGAAATTATTAGAGTTGGTGACAATAAGAAGATTCATCAGATTGAACTC
ATT
CCAAATGATCAGCTTGTTGCTGTGATCTCAGGACGAAATCGTCATGTACGACTTTTTCCTATGTCAG
CA
TTGGATGGGCGAGAGACCGATTTTTACAAGCTGTCAGAAACTAAAGGGTGTCAAACCGTAACTTCTGG
A
AAGGTGCGCCATGGAGCTCTCACATGCCTGTGTGTGGCTATGAAAAGGCAGGTCCTCTGTTATGAACTA
TTT
CAGAGCAAGACCCGTCACAGAAAATTTAAAGAAATTCAAGTCCCATATAATGTCCAGTGGATGGCAA
TC
TTCAGTGAACAACTCTGTGTGGGATTCCAGTCAGGATTTCTAAGATACCCCTTGAATGGAGAAGGAAA
T
CCATACAGTATGCTCCATTCAAATGACCATACACTATCATTTATTGCACATCAACCAATGGATGCTATC
TGC
GCAGTTGAGATCTCCAGTAAAGAATATCTGCTGTGTTTTAACAGCATTGGGATATACACTGACTGCC
AG
GGCCGAAGATCTAGACAACAGGAATTGATGTGGCCAGCAAATCCTTCCTCTTGTTGTTACAATGCACC
A
TATCTCTCGGTGTACAGTGAAAATGCAGTTGATATCTTTGATGTGAACTCCATGGAATGGATTCAGACT
CTT
CCTCTCAAAAAGGTTCGACCCTTAAACAATGAAGGATCATTAAATCTTTTAGGGTTGGAGACCATTA
GA
TTAATATATTTCAAAAATAAGATGGCAGAAGGGGACGAACTGGTAGTACCTGAAACATCAGATAATAG
T
CGGAAACAAATGGTTAGAAACATTAACAATAAGCGGCGTTATTCCTTCAGAGTCCCAGAAGAGGAAAGG
ATG
CAGCAGAGGAGGGAAATGCTACGAGATCCAGAAATGAGAAATAAATTAATTTCTAATCCAACTAATT
TT
AATCACATAGCACACATGGGTCCTGGAGATGGAATACAGATCCTGAAAGATCTGCCCATGAACCCTCG
G
CCTCAGGAAAGTCGGACAGTATTCAGTGGCTCAGTCAGTATTCCATCTATCACCAAATCCCGCCCTGAG
CCA
GGCCGCTCCATGAGTGCTAGCAGTGGCTTGTCAGCAAGGTCATCCGCACAGAATGGCAGCGCATTAA
AG
AGGGAATTCTCTGGAGGAAGCTACAGTGCCAAGCGGCAGCCCATGCCCTCCCCGTCAGAGGGCTCTTT
G
TCCTCTGGAGGCATGGACCAAGGAAGTGATGCCCCAGCGAGGGACTTTGACGGAGAGGACTCTGACTCT
CCG
AGGCATTCCACAGCTTCCAACAGTTCCAACCTAAGCAGCCCCCCAAGCCCAGCTTCACCCCGAAAAA
CC
AAGAGCCTCTCCCTGGAGAGCACTGACCGCGGGAGCTGGGACCCGTGA


Translation (1719 aa):
MSGEVRLRQLEQFILDGPAQTNGQCFSVETLLDILICLYDECNNSPLRREKNILEYLEWAKPFTSKVKQM
R
LHREDFEILKVIGRGAFGE
VAVVKLKNADKVFAMKILNKWEMLKRAETACFREERDVLVNGDNKWITTL
H
YAFQDDNNL
YLVMDYYVGGDLLTLLSKFEDRLPEDMARFYLAEMVIAIDSVHQLHYVHRDIKPDNILMD
M
NGHIRLADFGSCLKLMEDGT
VQSSVAVGTPDYISPEILQAMEDGKGRYGPECDWWSLGVCMYEMLYGET
P
FYAESLVETYGKIMNHK
ERFQFPAQVTDVSENAKDLIRRLICSREHRLGQNGIEDFKKHPFFSGIDWDN
I
RNCEAPYIPEVSSPTDTSNFDVDDDCLKNS
ETMPPPTHTAFSGHHLPFVGFTYTSSCVLSDRSCLRVTA
G
PTSLDLDVNVQRTLDNNLATEAYERRIKRLEQEKLELSRKLQ
ESTQTVQALQYSTVDGPLTASKDLEIK
N
LKEEIEKLRKQVT
ESSHLEQQLEEANAVRQELDDAFRQIKAYEKQIKTLQQEREDLNKELVQASERLKN
Q
SKELKDAHCQRKLAMQEFMEINERLTELHTQKQKLARHVRDKEEEVDLVMQKVESLRQELRRTERAKKE

L
EVHTEALAAEASKDRKLREQSEHYSKQLENELEGLK
QKQISYSPGVCSIEHQQEITKLKTDLEKKSIFY
E
EELSKREGIHANEIKNLKKELHDSEGQQLALNKEIMILKDKLEKTRRE
SQSEREEFESEFKQQYEREKV
L
LTEENKKLTSELDK
LTTLYENLSIHNQQLEEEVKDLADKKESVAHWEAQITEIIQWVSDEKDARGYLQA
L
ASKMTEELEALRNSSLGTRAT
DMPWKMRRFAKLDMSARLELQSALDAEIRAKQAIQEELNKVKASNIIT
E
CKLKDSEKKNLELLSEIEQLIKDTEELRSEKGIEHQDSQHSFLAFLNTPTDALDQFETVDSTPLSVHTP
T
LRKKGCPGSTGFPPK
RKTHQFFVKSFTTPTKCHQCTSLMVGLIRQGCSCEVCGFSCHITCVNKAPTTCP
V
PPEQTKGPLGIDPQKGIGTAYEGHVR
IPKPAGVKKGWQRALAIVCDFKLFLYDIAEGKASQPSVVISQV
I
DM
RDEEFSVSSVLASDVIHASRKDIPCIFRVTASQLSASNNKCSILMLADTENEKNKWVGVLSELHKIL
K
KNKFRDRSVYVPKEAYDSTLPLIKTTQAAAII
DHERIALGNEEGLFVVHVTKDEIIRVGDNKKIHQIEL
I
PNDQLVAVISGRNRHVRLFPMSALDGRETDFYKLSETKGCQTVTSGKVRHGALTCLCVAMKRQVLCYEL
F
QSKTRHRKFKEIQVPYNVQWMAIFSEQLCVGFQSGFLRYPLNGEGNPYSMLHSNDHTLSFIAHQPMDAI
C
AVEISSKEYLLCFNSIGIYTDCQGRRSRQQELMWPANPSSC
CYNAPYLSVYSENAVDIFDVNSMEWIQT
L
PLKK
VRPLNNEGSLNLLGLETIRLIYFKNKMAEGDELVVPETSDNSRKQMVRNINNKRRYSFRVPEEER
M
QQR
REMLRDPEMRNKLISNPTNFNHIAHMGPGDGIQILKDLPMNPRPQESRTVFSGSVSIPSITKSRPE
P
GRSMSASSGLSA
RSSAQNGSALKREFSGGSYSAKRQPMPSPSEGSLSSGGMDQGSDAPARDFDGEDSDS
P
RHSTASNSSNLSSPPSPASPRKTKSLSLESTDRGSWDP




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser