NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS15469.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
15469.1 Public Mus musculus 1 Sh2d1b2 23 108 98 CCDS HistoryNCBI Gene:545378Re-query CCDS DB by CCDS ID:15469.1Re-query CCDS DB by GeneID:545378See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 15469.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000162752.1 ENSMUSP00000125121.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000162752.1Link to Ensembl Protein Viewer:ENSMUSP00000125121.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000162752Re-query CCDS DB by Protein ID:ENSMUSP00000125121
Original member Current member NCBI NM_001033499.1 NP_001028671.1 Accepted alive Link to Nucleotide Sequence:NM_001033499.1Link to Protein Sequence:NP_001028671.1Re-query CCDS DB by Nucleotide ID:NM_001033499Re-query CCDS DB by Protein ID:NP_001028671Link to BLAST:NP_001028671.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001028671.1 132 Q45HK4 132 100% 0 0

Chromosomal Locations for CCDS 15469.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 1 (NC_000067.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 170232871 170233004 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 170248133 170248196 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 170250029 170250191 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 170251550 170251587 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (399 nt):
ATGGATCTGCCTTACTACCATGGCTGCCTGACCAAGCGAGAGTGTGAAGCCCTGCTCCTCAAGGGAGGTG
TG
GATGGCAACTTTCTGATAAGAGACAGCGAGTCTGTGCCAGGAGCCCTGTGCCTCTGTGTCTCGTTTAA
A
AAGCTTGTCTACAACTACCGAATCTTCAGAGAGAAAAATGGATATTACAGGATAGAGACTGAGCCCAGT
ACT
CCAAAAACAATCTTTCCAAACCTAGAGGAATTAATCTCCAAATTTAAAACGCCAGGTCAAGGAATGG
TG
GTTCATCTTTCAAACCCAATAATGAGAAGCGGCTTCTGTCCAGGAGCGAGAAGACTGAACTTAGAGGC
G
AATGTTTACGAGAACACTGATGAGGAGTATGTGGACGTCTTGCCTTGA


Translation (132 aa):
MDLPYYHGCLTKRECEALLLKGGVDGNFLIRDSESVPGALCLCVSFKKLVYNYRIFREKNGYYRIETEPS
T
PKTIFPNLEELISKFKTPGQGMVVHLSNPIMRSGFCPGARRLNLEANVY
ENTDEEYVDVLP



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser