NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq

Report for CCDS15450.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
15450.1 Public Mus musculus 1 Tada1 23 108 98 CCDS HistoryNCBI Gene:27878Re-query CCDS DB by CCDS ID:15450.1Re-query CCDS DB by GeneID:27878See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 15450.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000027846.7 ENSMUSP00000027846.7 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000027846.7Link to Ensembl Protein Viewer:ENSMUSP00000027846.7Re-query CCDS DB by Nucleotide ID:ENSMUST00000027846Re-query CCDS DB by Protein ID:ENSMUSP00000027846
Original member Current member NCBI NM_030245.3 NP_084521.1 Accepted alive Link to Nucleotide Sequence:NM_030245.3Link to Protein Sequence:NP_084521.1Re-query CCDS DB by Nucleotide ID:NM_030245Re-query CCDS DB by Protein ID:NP_084521Link to BLAST:NP_084521.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_084521.1 335 Q99LM9 335 100% 0 0

Chromosomal Locations for CCDS 15450.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 1 (NC_000067.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 166379403 166379476 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 166382127 166382218 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 166382397 166382462 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 166386666 166386763 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 166388562 166388771 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 166389836 166389987 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 166391823 166391985 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 166392568 166392720 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1008 nt):
ATGGCGACCTTTGTGAGCGAGCTGGAGGCAGCCAAGAAGAACTTGAGCGAGGCGCTGGGGGACAACGTGA
AA
CAATACTGGGCCAACCTGAAGTTGTGGTTCAAGCAGAAGATCAGCAAGGAGGAGTTCGACCTTGAAGC
T
CACAGACTCCTCACACAGGACAATGTGCATTCTCACAATGACTTCCTCCTGGCCATCCTCACACGTTGT
CAG
ATTTTGGTTTCTACACCAGAGGGTGCTGGATCTTTGCCCTGGACAGGGGGCTCTGCAGCCAAGCCTG
GA
AAACCCAAGGGCAAGAAAAAGCTTTCTTCTGTTCGTCAAAAATTTGATCATAGGTTCCAGCCTCAGAA
C
CCCCTCTCTGGAGCTCAGCAGTTCGTGGCAAAGGAGCCCCAGGGTGATGACGACTTGAAACTTTGTTCA
CAC
ACCATGATGCTTCCCACGCGAGGCCAACTTGAAGGGAGAATGATCGTGACTGCCTATGAGCACGGGC
TG
GACAATGTCACTGAGGAGGCCGTGTCTGCCGTGGTCTATGCCGTGGAGAATCACCTCAAAGATATTCT
G
ACCTCAGTTGTGTCGAGAAGGAAAGCTTACCGGGTACGGGATGGTCATTTTAAATACGCCTTTGGGAGC
AAC
GTGACGCCACAGCCATACCTGAAGAATAGTGTGGTGGCTTACAACAACTTGGTTGAAGGCCCTCCAG
CC
TTCTCTGCTCCATGTGCCAATCAGAGCCCAGCGTCTCAGCCACACCCCGACGATGCTGAGCAGCAGGC
T
GCATTCCTATTGGCCTGCTCGGGGGACACGCTACCTGCATCTCTGCCTCCAGTGAACATGTATGACCTG
TTT
GAAGCTTTGCAGGTCCACAGGGAAGTCATTCCTACACATACTGTGTATGCCCTTAACATTGAAAGGA
TC
ATCATGAAACTCTGGCACCCCAATCACGAAGAGCTACAACAAGACAAAGTCCACCGCCAGCGCCTGGC
A
GCCAAAGAAGGACTTTTGCTCTGCTAA


Translation (335 aa):
MATFVSELEAAKKNLSEALGDNVKQYWANLKLWFKQKISKEEFDLEAHRLLTQDNVHSHNDFLLAILTRC
Q
ILVSTP
EGAGSLPWTGGSAAKPGKPKGKKKLSSVRQKFDHRFQPQNPLSGAQQFVAKEPQGDDDLKLCS
H
TMMLPTRGQLEGRMIVTAYEHGLDNVTEEAVSAVVYAVE
NHLKDILTSVVSRRKAYRVRDGHFKYAFGS
N
VTPQPYLKNSVVAYNNLVE
GPPAFSAPCANQSPASQPHPDDAEQQAAFLLACSGDTLPASLPPVNMYDL
F
EALQ
VHREVIPTHTVYALNIERIIMKLWHPNHEELQQDKVHRQRLAAKEGLLLC



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser