NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS15326.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
15326.1 Public Mus musculus 1 Ddx59 23 108 98 CCDS HistoryNCBI Gene:67997Re-query CCDS DB by CCDS ID:15326.1Re-query CCDS DB by GeneID:67997See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 15326.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000027655.7 ENSMUSP00000027655.6 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000027655.7Link to Ensembl Protein Viewer:ENSMUSP00000027655.6Re-query CCDS DB by Nucleotide ID:ENSMUST00000027655Re-query CCDS DB by Protein ID:ENSMUSP00000027655
Original member Current member NCBI NM_026500.3 NP_080776.1 Accepted alive Link to Nucleotide Sequence:NM_026500.3Link to Protein Sequence:NP_080776.1Re-query CCDS DB by Nucleotide ID:NM_026500Re-query CCDS DB by Protein ID:NP_080776Link to BLAST:NP_080776.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_080776.1 619 Q9DBN9-1 619 100% 0 0

Chromosomal Locations for CCDS 15326.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 1 (NC_000067.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 136416593 136417396 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 136419410 136419577 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 136424795 136424884 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 136432312 136432563 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 136433713 136433865 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 136434506 136434634 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 136439753 136440016 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1860 nt):
ATGTTTGTTCCAAGATCTTTGAAAATCAAGAGGAGTTCTAATGATGACCTCAAAAGCGGTGAAGCTAAAA
AA
AGCAAGCCAGAAGCAGGAGGCCTTCAGGTGGAGGGAGACAGAGATACTCCGGTCCACACATCAGTCAC
T
GAGGAAGCTGTCACAGCAGACAAGCCCGGCCATGCATCAAGCACCAACAGTCCTTCTTGCCAGTTGGCT
GAG
GTTTCTTCCACAGGACCTGATGAGGGTGTGAAGGACAGCCACCCATCTGAAGAGCCTGTAAAGTCGT
TT
TCTAAAACCCAGCGGTGGCCAGAGCCTGGGGAGCCTGTATGTGTCGTCTGCGGTCGTTATGGAGAGTA
T
ATCTGTGACAAGACGGACGAAGACGTGTGTAGCTTGGAGTGCAAAGCGAAGCATCTGCTACAAGTTAAG
GAA
GGGGAAGGATCATTAAGACCCAGCAGCCCACAGAGAGTGGCTGCCGAGCCAGAGTCCCCACTGGATG
CC
TTTTATGTCTACAAAGAGCACCCCTTTATTGTGACCCTCAAGGAGGACCAGATTGAAACCCTTAAACA
G
CAGCTAGGAATCTCAGTTCAAGGACAAGACGTTGCCAGGCCCATTATCGACTTCGAGCACTGTGGCTTC
CCT
GAGACCTTAAATCAGAACTTGAAGAAATCAGGCTACGAAGTGCCAACCCCCATCCAGATGCAGATGA
TT
CCTGTGGGGCTCCTGGGAAGGGACATTCTGGCCAGCGCTGACACTGGCTCAGGGAAAACAGCTGCTTT
T
CTCCTGCCTGTTATTATCCGAGCTTTCTCTGAGGATAAAACTCCATCCGCACTCATTCTCACACCGACA
AGA
GAACTGGCCATTCAGATAGAGAGGCAGGCCAAGGAACTGATGAGTGGTCTGCCTCGCATGAAGACAG
TG
CTTCTCGTAGGGGGCTTACCTCTGCCCCCACAGCTCTATCGCTTACGGCAGCATGTTAAGGTTATCAT
A
GCAACCCCTGGACGACTTCTGGATATAATTAAACAGAGCTCCGTATCACTCAGTGGCATAAAAATTGTC
GTA
GTAGACGAAGCTGACACCATGTTGAAGATGGGCTTTCAGCAGCAAGTGCTTGACGTTTTGGAACACA
CT
CCTGGTGACTGTCAGACCATCTTGGTTTCTGCCACCATTCCAGATAGCATAGAACAGCTCACAGACCA
G
CTTCTGCATAATCCTGTGAGGATCATCACTGGGGACAAGAACCTGCCCTGCGCCAGTGTGCGGCAGATC
ATC
CTGTGGGTAGAAGACCCAGCTAAAAAGAAGAAATTATTTGAAATCCTAAATGATCAGAAGCTCTTTA
AG
CCTCCAGTGTTAGTATTCGTGGACTGCAAACTAGGCGCAGATCTGTTGAGCGAGGCGGTTCAGAAGAT
C
ACAGGTCTGAACAGCACATCCATCCACTCAGAGAAGTCTCAGGTGGAAAGGAGGGACATCCTGAAGGGA
TTA
CTGGAAGGAGACTATGAGGTCGTGGTGAGCACGGGGGTCCTGGGTCGGGGCCTAGACTTGGTCAACG
TC
AAGCTGGTTGTGAATTTTGATATGCCTTCAAGCATGGATGAGTATGTGCACCAGGTTGGCAGAGTTGG
G
AGACTCGGTCAAAATGGAACTGCAATCACATTCATCAATAACAACTCTAAAAGACTCTTCTGGGATGTT
GCC
AAAAGAGTGAAGCCCACGGGATCCATTCTCCCGCCACAGCTATTAAATTCCCCTTACCTTCATGAGC
AG
AAGAGAAAGGAACAGCAGAAAGACAGACAGACACAGAACAGCCTGGTCACGGGGGCCAACCTCATGGA
C
ATTATTAGGAAACACGAAAAGAGCAGTTCACAGAAATGA


Translation (619 aa):
MFVPRSLKIKRSSNDDLKSGEAKKSKPEAGGLQVEGDRDTPVHTSVTEEAVTADKPGHASSTNSPSCQLA
E
VSSTGPDEGVKDSHPSEEPVKSFSKTQRWPEPGEPVCVVCGRYGEYICDKTDEDVCSLECKAKHLLQVK
E
GEGSLRPSSPQRVAAEPESPLDAFYVYKEHPFIVTLKEDQIETLKQQLGISVQGQDVARPIIDFEHCGF
P
ETLNQNLKKSGYEVPTPIQMQMIPVGLLGRDILASADTGSGKTAAFLLPVIIRAFSE
DKTPSALILTPT
R
ELAIQIERQAKELMSGLPRMKTVLLVGGLPLPPQLYRLRQHVK
VIIATPGRLLDIIKQSSVSLSGIKIV
V
VDE
ADTMLKMGFQQQVLDVLEHTPGDCQTILVSATIPDSIEQLTDQLLHNPVRIITGDKNLPCASVRQI
I
LWVEDPAKKKKLFEILN
DQKLFKPPVLVFVDCKLGADLLSEAVQKITGLNSTSIHSEKSQVERRDILKG
L
LEGDYEVVVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQ
VGRVGRLGQNGTAITFINNNSKRLFWDV
A
KRVKPTGSILPPQLLNSPYLHEQKRKEQQKDRQTQNSLVTGANLMDIIRKHEKSSSQK




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser