NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS15317.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
15317.1 Public Mus musculus 1 Rnpep 23 108 98 CCDS HistoryNCBI Gene:215615Re-query CCDS DB by CCDS ID:15317.1Re-query CCDS DB by GeneID:215615See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 15317.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000077340.13 ENSMUSP00000076564.7 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000077340.13Link to Ensembl Protein Viewer:ENSMUSP00000076564.7Re-query CCDS DB by Nucleotide ID:ENSMUST00000077340Re-query CCDS DB by Protein ID:ENSMUSP00000076564
Original member Current member NCBI NM_145417.3 NP_663392.2 Accepted alive Link to Nucleotide Sequence:NM_145417.3Link to Protein Sequence:NP_663392.2Re-query CCDS DB by Nucleotide ID:NM_145417Re-query CCDS DB by Protein ID:NP_663392Link to BLAST:NP_663392.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_663392.2 650 Q8VCT3 650 100% 0 0

Chromosomal Locations for CCDS 15317.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 1 (NC_000067.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 135262971 135263129 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 135264053 135264195 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 135265183 135265407 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 135266870 135266978 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 135267170 135267282 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 135268083 135268196 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 135271529 135271764 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 135272362 135272478 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 135277389 135277537 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 135278767 135278907 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 135283562 135284008 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1953 nt):
ATGGAGAGCGGCGGACCAGGCAACTACAGCGCGGCCGCCCGGCGGCCACTGCACTCGGCCCAAGCCGTGG
AC
GTGGCCTCGGCCTCCAGCTTCCGCGCCTTCGAGATCCTGCACCTGCACCTGGACCTGCGGGCCGAGTT
C
GGGCCTCCGGGCCCGGGTCCGGGAAGCCGCGGATTGAGCGGCACGGCGACGCTGGAGCTGCGTTGTTTG
CTT
CCCGAGGGCGCCTCGGAGCTGCGGCTCGACTCGCACAGCTGCTTGGAGGTGACGGCGGCGACGCTGC
GA
CGGGGACAGCCGGGAGACCAGCAGGCGCCGGCAGAGCCCGTGCCTTTCCACACACAGCCCTTCTCGCA
C
TATGGCCAGGCCCTGTGCGTGGCCTTCCGGCAGCCCTGCGGTGCCGCCGATCGCTTCGAGCTGGAGCTC
ACC
TACCGCGTCGGGGAGGGACCCGGGGTTTGCTGGTTGGCTCCTGAGCAGACAGCAGGAAAGAAGAAAC
CC
TTTGTCTATACCCAGGGTCAGGCGGTCTTAAACCGAGCCTTTTTCCCTTGCTTTGACACTCCAGCAGT
G
AAATGCACGTATTCGGCTCTTATTGAGGTTCCAGATGGCTTCACAGCTGTGATGAGTGCAGACACCTGG
GAG
AAGAGAGGACCAAATAAGTTCTTCTTCCAGATGAGCCATCCCATCCCCTCCTATCTGATAGCTTTGG
CC
ATTGGAGATCTGGCTTCAGCTGAGGTTGGACCCAGGAGCCGGGTGTGGGCGGAGCCCTGCCTGATTGA
A
GCTGCCAAGGAGGAATACAGTGGGGTCATAGAAGAATTTCTGGCAACAGGAGAGAAGCTTTTCGGACCC
TAT
GTTTGGGGAAGGTATGACTTGCTCTTTATGCCACCGTCCTTTCCATTTGGAGGAATGGAAAATCCTT
GC
CTGACCTTTGTCACTCCGTGCCTGCTAGCAGGGGACCGCTCGTTAGCCGACGTTATCATCCATGAGAT
C
TCCCACAGTTGGTTTGGGAACCTGGTCACCAATGCCAACTGGGGGGAGTTCTGGCTCAATGAAGGCTTC
ACC
ATGTATGCCCAGAGGAGGATCTCCACCATCCTGTTTGGAGCTGCTTACACTTGCTTGGAGGCTGCCA
CA
GGGAGGGCTCTGCTGCGTCAGCACATGAATGTCTCCGGAGAGGAAAACCCACTCAACAAGCTCCGGGT
G
AAGATTGAACCAGGTGTGGACCCCGATGACACCTACAATGAGACCCCCTACGAGAAAGGTTACTGCTTT
GTC
TCATACCTGGCCCACCTGGTGGGTGATCAGGATCAGTTTGACAAGTTTCTCAAGGCCTATGTAGATG
AG
TTTAAATTCCAAAGTATCTTGGCTGAAGACTTTCTGGAATTCTACCTGGAGTATTTCCCTGAGTTGAA
G
AAGAAGGGAGTAGATTCCATTCCAGGTTTTGAGTTTGATCGATGGCTGAACACCCCTGGATGGCCCCCC
TAC
CTCCCCGACCTCTCCCCTGGGGACTCACTCATGAAGCCAGCTGAAGAGCTGGCAGAACTGTGGGTGA
CC
TCAGAGCCAGACATGCAAGCCATTGAAGCCGTGGCCATCTCTACCTGGAAGACCTACCAGCTTGTCTA
C
TTCCTAGATAAGATCTTGCAGAAGTCTCCTCTCCCTCCTGGGAATGTGAAAAAACTTGGGGAGACATAC
CCA
AAGATTTCCAATGCTCAGAATGCTGAGTTACGGCTAAGATGGGGCCAAATCATCCTTAAGAATGACT
AC
CAAGAGGAATTCCAGAAAGTGAAGGACTTCCTGCAGAGCCAGGGAAAGCAGAAGTACACTCTGCCTCT
G
TACCACGCCATGATGGGTGGCAGTGAGATGGCCCGGACCCTGGCCAAGGACACCTTTGCCGCCACTGCT
TCC
CAGCTCCACAGCAACGTCGTCAACTATGTCCAGCAGATCCTGGCGCCCAAGGACAGTTAG


Translation (650 aa):
MESGGPGNYSAAARRPLHSAQAVDVASASSFRAFEILHLHLDLRAEFGPPGPGPGSRGLSGTATLELRCL
L
PEGASELRLDSHSCLEVTAATLRRGQPGDQQAPAEPVPFHTQPFSHYGQALCVAFRQPCGAADRFELEL
T
YRVGEGPG
VCWLAPEQTAGKKKPFVYTQGQAVLNRAFFPCFDTPAVKCTYSALIEVPDGFTAVMSADTW
E
KRGPNKFFFQMSHPIPSYLIALAIGDLASAEVGP
RSRVWAEPCLIEAAKEEYSGVIEEFLATGEKLFGP
Y
VWG
RYDLLFMPPSFPFGGMENPCLTFVTPCLLAGDRSLADVIIHEISHSWFGNLVTNANWGEFWLNEGF
T
MYAQRRISTILF
GAAYTCLEAATGRALLRQHMNVSGEENPLNKLRVKIEPGVDPDDTYNETPYEKGYCF
V
SYLAHLVGDQDQFDKFLK
AYVDEFKFQSILAEDFLEFYLEYFPELKKKGVDSIPGFEFDRWLNTPGWPP
Y
LPDLSPGDSLMKPAEELAELWVTSEPDMQAIEAVAISTWKTYQLVYFLDKILQKSPLPP
GNVKKLGETY
P
KISNAQNAELRLRWGQIILKNDYQEEFQKVKDFLQSQ
GKQKYTLPLYHAMMGGSEMARTLAKDTFAATA
S
QLHSNVVNYVQQILAPKDS




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser