NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq

Report for CCDS15190.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
15190.1 Public Mus musculus 1 Septin2 23 108 98 CCDS HistoryNCBI Gene:18000Re-query CCDS DB by CCDS ID:15190.1Re-query CCDS DB by GeneID:18000See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 15190.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000027495.14 ENSMUSP00000027495.8 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000027495.14Link to Ensembl Protein Viewer:ENSMUSP00000027495.8Re-query CCDS DB by Nucleotide ID:ENSMUST00000027495Re-query CCDS DB by Protein ID:ENSMUSP00000027495
Original member Current member EBI ENSMUST00000168776.7 ENSMUSP00000132850.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000168776.7Link to Ensembl Protein Viewer:ENSMUSP00000132850.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000168776Re-query CCDS DB by Protein ID:ENSMUSP00000132850
Original member Current member EBI ENSMUST00000179353.7 ENSMUSP00000136366.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000179353.7Link to Ensembl Protein Viewer:ENSMUSP00000136366.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000179353Re-query CCDS DB by Protein ID:ENSMUSP00000136366
Original member Current member NCBI NM_001159717.1 NP_001153189.1 Accepted alive Link to Nucleotide Sequence:NM_001159717.1Link to Protein Sequence:NP_001153189.1Re-query CCDS DB by Nucleotide ID:NM_001159717Re-query CCDS DB by Protein ID:NP_001153189Link to BLAST:NP_001153189.1
Original member NCBI NM_001159719.1 NP_001153191.1 Updated not alive Link to Nucleotide Sequence:NM_001159719.1Link to Protein Sequence:NP_001153191.1Re-query CCDS DB by Nucleotide ID:NM_001159719Re-query CCDS DB by Protein ID:NP_001153191
Current member NCBI NM_001159719.2 NP_001153191.1 Accepted alive Link to Nucleotide Sequence:NM_001159719.2Link to Protein Sequence:NP_001153191.1Re-query CCDS DB by Nucleotide ID:NM_001159719Re-query CCDS DB by Protein ID:NP_001153191Link to BLAST:NP_001153191.1
Original member Current member NCBI NM_010891.2 NP_035021.1 Accepted alive Link to Nucleotide Sequence:NM_010891.2Link to Protein Sequence:NP_035021.1Re-query CCDS DB by Nucleotide ID:NM_010891Re-query CCDS DB by Protein ID:NP_035021Link to BLAST:NP_035021.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001153189.1 361 P42208 361 100% 0 0
NP_001153191.1 361 P42208 361 100% 0 0
NP_035021.1 361 P42208 361 100% 0 0

Chromosomal Locations for CCDS 15190.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 1 (NC_000067.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 93489146 93489154 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 93491157 93491277 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 93495579 93495665 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 93497341 93497464 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 93499012 93499146 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 93499273 93499390 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 93500458 93500559 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 93501507 93501652 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 93503435 93503518 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 93505544 93505601 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 93506963 93507064 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1086 nt):
ATGTCTAAGCAACAACCAACTCAGTTTATAAATCCAGAAACTCCTGGCTATGTTGGATTTGCAAATCTTC
CC
AATCAAGTTCACCGAAAATCAGTGAAGAAGGGGTTCGAGTTCACTCTGATGGTGGTTGGTGAATCTGG
T
CTAGGAAAATCAACTCTCATAAACAGCTTATTCCTGACTGATCTCTACCCAGAAAGAATTATTCCTGGA
GCT
GCAGAGAAAATTGAAAGAACTGTCCAGATAGAGGCTTCGACTGTTGAGATTGAAGAGCGGGGTGTGA
AG
CTGCGGCTTACAGTAGTGGACACTCCCGGCTACGGGGATGCCATCAACTGCAGGGATTGTTTCAAGAC
A
ATTATCTCCTACATTGATGAGCAGTTTGAACGCTACCTACATGATGAGAGTGGACTGAACAGGCGTCAC
ATC
ATTGATAACAGGGTACATTGTTGCTTCTACTTCATTTCACCTTTTGGACATGGACTGAAGCCCTTAG
AT
GTTGCATTTATGAAAGCGATACACAATAAGGTGAATATTGTGCCTGTCATTGCGAAAGCTGACACTCT
C
ACTCTGAAGGAGCGTGAGCGGCTTAAGAAAAGGATTTTGGATGAAATTGAAGAGCATAGCATTAAAATC
TAT
CACTTACCTGATGCAGAGTCAGATGAAGATGAAGACTTTAAGGAGCAGACTAGACTCCTCAAGGCCA
GT
ATCCCATTCTCTGTGGTTGGCTCCAACCAGTTGATTGAAGCCAAAGGCAAGAAGGTTAGAGGCCGTCT
C
TACCCATGGGGTGTTGTAGAGGTGGAGAACCCAGAACACAATGACTTTCTGAAGCTGAGAACGATGCTC
AT
C
ACCCACATGCAGGACCTACAGGAAGTGACCCAAGACCTTCACTATGAAAACTTCCGTTCTGAGAGGC
TG
AAGAGAGGCGGCAGGAAAGTAGAGAATGAGGACATGAATAAAGACCAGATCTTGCTTGAAAAGGAGGC
T
GAGCTCCGCCGCATGCAAGAGATGATTGCAAGAATGCAAGCGCAGATGCAGATGCAGATGCAGGGTGGT
GAC
AGTGACAGCGGGGCTCTCGGGCAGCATGTGTGA


Translation (361 aa):
MSKQQPTQFINPETPGYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGKSTLINSLFLTDLYPERIIPG
A
A
EKIERTVQIEASTVEIEERGVKLRLTVVDTPGYGDAINCRDCFKTIISYIDEQFERYLHDESGLNRRH
I
IDNRVHCCFYFISPFGH
GLKPLDVAFMKAIHNKVNIVPVIAKADTLTLKERERLKKRILDEIEEHSIKI
Y
HLPDAESDEDEDFKEQTRLLK
ASIPFSVVGSNQLIEAKGKKVRGRLYPWGVVEVENPEHNDFLKLRTML
I
THMQDLQEVTQDLHYENFRSERLKRGGRKVENEDMNKDQILLEKEAELRRMQEMIARMQAQMQMQMQGG
D
SDSGALGQHV




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser