NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Wednesday, October 16, 2019, starting at 8:00 a.m. EDT for approximately 30 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS15189.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
15189.1 Public Mus musculus 1 Hdlbp 21 106 86 CCDS HistoryNCBI Gene:110611Re-query CCDS DB by CCDS ID:15189.1Re-query CCDS DB by GeneID:110611See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 15189.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000042498 ENSMUSP00000043047 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000042498Link to Ensembl Protein Viewer:ENSMUSP00000043047Re-query CCDS DB by Nucleotide ID:ENSMUST00000042498Re-query CCDS DB by Protein ID:ENSMUSP00000043047
Original member Current member EBI,WTSI ENSMUST00000170883 ENSMUSP00000127903 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000170883Link to Ensembl Protein Viewer:ENSMUSP00000127903Re-query CCDS DB by Nucleotide ID:ENSMUST00000170883Re-query CCDS DB by Protein ID:ENSMUSP00000127903
Original member Current member EBI,WTSI OTTMUST00000124600 OTTMUSP00000067768 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000124600Link to Vega Protein Viewer:OTTMUSP00000067768Re-query CCDS DB by Nucleotide ID:OTTMUST00000124600Re-query CCDS DB by Protein ID:OTTMUSP00000067768
Original member Current member EBI,WTSI OTTMUST00000124601 OTTMUSP00000067769 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000124601Link to Vega Protein Viewer:OTTMUSP00000067769Re-query CCDS DB by Nucleotide ID:OTTMUST00000124601Re-query CCDS DB by Protein ID:OTTMUSP00000067769
Original member Current member NCBI NM_001301364.1 NP_001288293.1 Accepted alive Link to Nucleotide Sequence:NM_001301364.1Link to Protein Sequence:NP_001288293.1Re-query CCDS DB by Nucleotide ID:NM_001301364Re-query CCDS DB by Protein ID:NP_001288293Link to BLAST:NP_001288293.1
Original member Current member NCBI NM_133808.5 NP_598569.1 Accepted alive Link to Nucleotide Sequence:NM_133808.5Link to Protein Sequence:NP_598569.1Re-query CCDS DB by Nucleotide ID:NM_133808Re-query CCDS DB by Protein ID:NP_598569Link to BLAST:NP_598569.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001288293.1 1268 Q8VDJ3 1268 100% 0 0
NP_598569.1 1268 Q8VDJ3 1268 100% 0 0

Chromosomal Locations for CCDS 15189.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 1 (NC_000067.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 93408173 93408259 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93408369 93408497 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93408689 93408805 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93408951 93409136 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93412363 93412506 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93413491 93413625 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93413827 93413931 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93414812 93414966 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93416501 93416639 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93417172 93417390 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93417468 93417689 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93420069 93420287 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93421084 93421215 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93421343 93421429 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93423264 93423377 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93423770 93423874 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93425267 93425406 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93427558 93427636 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93428148 93428252 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93429378 93429485 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93430098 93430304 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93430955 93431170 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93431312 93431518 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93437094 93437309 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93438226 93438383 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93440680 93440755 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3807 nt):
ATGAGCTCCGTTGCAGTTTTGACCCAAGAGAGTTTTGCTGAACATCGAAGTGGGCTGGTTCCACAACAAA
TC
AAAGTTGCCACCTTAAATTCAGAAGAGGAAAATGACCCTCCAACCTACAAGGATGCCTTCCCTCCACT
T
CCTGAGAAAGCAGCTTGCTTGGAGAGTGCCCAAGAACCTGCCGGAGCCTGGAGTAACAAGATCCGGCCC
ATC
AAGGCCTCTGTCATCACTCAGGTGTTTCATGTACCCCTGGAAGAGAGAAAATATAAGGACATGAACC
AG
TTTGGAGAGGGTGAACAAGCAAAAATCTGCCTTGAGATCATGCAGAGGACTGGTGCTCACCTGGAACT
C
TCTCTGGCTAAAGATCAAGGTCTCTCCATCATGGTCTCAGGGAAGCTGGATGCCGTCATGAAAGCCCGC
AAA
GACATTGTTGCTAGACTACAGACACAGGCCTCAGCAACTGTTCCCATTCCTAAAGAGCACCATCGCT
TT
GTTATTGGCAAAAACGGAGAGAAACTGCAAGACTTAGAACTAAAAACTGCAACCAAAATCCAGATCCC
A
CGCCCAGATGACCCCAGTAATCAGATCAAGATCACTGGCACCAAAGAAGGCATCGAGAAAGCTCGCCAT
GAA
GTCCTCCTAATCTCTGCTGAGCAGGACAAGCGTGCTGTAGAGAGGCTAGAAGTGGAGAAGGCTTTCC
AC
CCCTTCATCGCTGGGCCGTACAACAGACTTGTGGGTGAAATCATGCAGGAGACAGGGACGCGAATCAA
C
ATCCCTCCACCCAGTGTTAACCGTACAGAAATCGTCTTCACTGGAGAGAAGGAGCAGCTGGCTCAGGCT
GTG
GCTCGCATTAAGAAGATTTATGAGGAAAAGAAGAAGAAGACTACAACCATTGCGGTAGAGGTGAAGA
AG
TCTCAGCACAAGTATGTTATTGGGCCAAAGGGCAATTCACTGCAAGAAATCCTGGAAAGAACTGGAGT
T
TCTGTTGAGATCCCACCCTCCGACAGCATCTCTGAGACTGTGATACTTAGAGGCGAACCTGAAAAGTTG
GGA
CAGGCGTTGACTGAAGTCTATGCCAAGGCCAACAGTTTTACAGTCTCCTCAGTCTCTGCCCCTTCCT
GG
CTTCATCGTTTCATCATTGGTAAGAAAGGGCAGAACCTGGCCAAAATCACTCAGCAAATGCCAAAGGT
T
CACATTGAGTTCACAGAAGGTGAGGACAAGATCACCCTGGAGGGCCCCACAGAGGATGTGAATGTAGCC
CAA
GAACAGATTGAAGGAATGGTCAAAGACCTGATTAATAGGATGGACTATGTAGAGATCAACATTGACC
AT
AAATTCCACAGACACCTCATTGGAAAGAGCGGAGCCAACATCAACAGAATCAAAGACCAGTACAAAGT
G
TCTGTGCGCATCCCCCCTGACAGTGAAAAGAGTAACCTGATCCGAATTGAGGGAGACCCACAGGGTGTT
CAG
CAGGCCAAGCGGGAGCTGCTGGAGCTTGCTTCTCGCATGGAAAATGAGCGCACCAAGGATCTAATCA
TC
GAGCAAAGATTTCATCGCACAATCATTGGGCAGAAAGGTGAACGGATTCGAGAAATTCGTGACAAATT
C
CCAGAGGTTATCATCAACTTTCCAGACCCAGCACAAAAAAGTGATATTGTACAACTCAGAGGCCCCAAG
AAT
GAGGTGGAGAAGTGCACTAAGTATATGCAGAAGATGGTCGCAGACCTGGTGGAAAATAGCTATTCAA
TT
TCTGTACCAATCTTCAAACAGTTTCACAAGAATATCATCGGGAAAGGAGGCGCAAACATTAAAAAGAT
C
CGTGAAGAGAGCAACACCAAGATTGACCTTCCTGCAGAGAACAGCAACTCTGAGACCATTATTATCACT
GGC
AAGCGAGCCAACTGTGAAGCTGCCCGCAGCCGGATTCTGTCTATCCAGAAAGATCTGGCCAACATAG
CT
GAAGTGGAGGTCTCAATTCCTGCCAAACTACACAACTCTCTCATTGGCACAAAGGGCCGTCTGATCCG
C
TCCATCATGGAGGAATGTGGTGGCGTCCATATTCACTTTCCTGTGGAAGGTTCTGGAAGCGACACTGTT
GTC
ATCAGGGGTCCTTCCTCAGATGTAGAGAAGGCCAAGAAGCAGCTCCTGCACCTGGCTGAGGAGAAGC
AA
ACCAAGAGTTTTACTGTGGACATCCGAGCCAAGCCAGAATACCACAAATTCCTCATTGGCAAAGGGGG
A
GGTAAAATCCGAAAGGTGCGTGACAGTACTGGAGCCCGCATCATATTTCCGGCTGCTGAAGATAAGGAC
CAG
GACCTGATCACAATCATAGGAAAGGAGGATGCTGTCCGTGAGGCCCAAAAGGAGCTGGAAGCATTGA
TC
CAGAACCTGGAGAATGTGGTTGAAGACTATATGCTGGTGGACCCCAAACACCACCGCCATTTTGTCAT
C
CGAAGAGGACAAGTTTTACGAGAAATTGCTGAAGAGTATGGCGGGGTGATGGTCAGCTTCCCACGCTCT
GGC
ACGCAGAGTGATAAAGTCACTCTCAAGGGTGCCAAGGACTGTGTGGAGGCAGCCAAGAAACGCATTC
AG
GAAATCATTGAGGATCTGGAAGCTCAAGTGACAGTGGAATGTGCTATACCCCAGAAGTTTCACCGATC
G
GTCATGGGTCCCAAAGGTTCAAGAATCCAGCAGATCACTCGGGACTACAATGTTCAAATCAAGTTCCCA
GAT
AGAGAGGAAAATCCAGTTCACAGTGTAGAGCCTTCCATCCAGGAGAATGGAGATGAGGCTGGAGAGG
GC
AGAGAGGCCAAGGAGACCGACCCTGGCTCTCCCAGGAGGTGTGACATCATAATCATCTCTGGCCGGAA
A
GAGAAATGCGAGGCTGCCAAGGAAGCCCTGGAGGCACTGGTTCCAGTCACCATCGAGGTAGAGGTACCC
TTT
GATCTTCACCGCTACATCATTGGGCAAAAAGGAAGTGGAATCCGCAAGATGATGGATGAGTTTGAGG
TG
AACATCCATGTACCAGCCCCCGAGCTGCAGTCAGACACCATCGCCATCACTGGCCTTGCAGCAAATTT
G
GACAGGGCTAAGGCGGGGCTACTGGATCGAGTAAAGGAGCTGCAGGCTGAGCAGGAAGATCGGGCTTTA
AGG
AGTTTTAAGCTGAGTGTCACTGTAGACCCCAAATACCATCCCAAAATTATCGGGAGAAAAGGAGCAG
TG
ATCACCCAGATCCGCTTGGAACATGAAGTGAACATCCAATTTCCTGATAAGGATGATGGGAACCAGCC
C
CAGGACCAAATCACCATCACAGGGTATGAGAAGAACACTGAAGCTGCCCGTGATGCTATCCTGAAAATT
GTG
GGTGAGCTTGAGCAGATGGTTTCTGAGGATGTTCCACTGGATCACCGTGTGCACGCTCGAATCATTG
GT
GCCCGGGGCAAAGCCATCCGGAAAATAATGGATGAATTCAAGGTGGACATTCGCTTCCCACAGAGTGG
A
GCGCCAGACCCCAATTGCGTCACTGTGACAGGACTCCCAGAGAATGTGGAGGAAGCTATCGACCATATC
CTC
AACCTAGAAGAGGAATATCTGGCAGATGTGGTGGACAGTGAGGCACTGCAAGTTTACATGAAGCCCC
CA
GCACATGAAGAGTCCAGGGCACCATCCAAAGGCTTTGTGGTGCGAGATGCTCCCTGGACCTCCAACAG
C
AGTGAGAAGGCTCCTGATATGAGCAGCTCTGAAGAATTTCCCAGCTTTGGGGCTCAAGTGGCCCCCAAG
ACC
CTCCCTTGGGGCCCCAAACGATAA


Translation (1268 aa):
MSSVAVLTQESFAEHRSGLVPQQIKVATLNSEEENDPPTYKDAFPPLPEKAACLESAQEPAGAWSNKIRP
I
KASVITQ
VFHVPLEERKYKDMNQFGEGEQAKICLEIMQRTGAHLELSLAKDQGLSIMVSGKLDAVMKAR
K
DIVARLQTQ
ASATVPIPKEHHRFVIGKNGEKLQDLELKTATKIQIPRPDDPSNQIKITGTKEGIEKARH
E
VLLISAEQ
DKRAVERLEVEKAFHPFIAGPYNRLVGEIMQETGTRINIPPPSVNRTEIVFTGEKEQLAQA
V
ARIKKIYEEK
KKKTTTIAVEVKKSQHKYVIGPKGNSLQEILERTGVSVEIPPSDSISETVILRGEPEKL
G
QALTEVYAK
ANSFTVSSVSAPSWLHRFIIGKKGQNLAKITQQMPKVHIEFTEGEDKITLEGPTEDVNVA
Q
EQIEGMVKDL
INRMDYVEINIDHKFHRHLIGKSGANINRIKDQYKVSVRIPPDSEKSNLIRIEGDPQGV
Q
QAKRELLELASRM
ENERTKDLIIEQRFHRTIIGQKGERIREIRDKFPEVIINFPDPAQKSDIVQLRGPK
N
EVEKCTKYMQKMVADL
VENSYSISVPIFKQFHKNIIGKGGANIKKIREESNTKIDLPAENSNSETIIIT
G
KRANCEAARSRILSIQKDL
ANIAEVEVSIPAKLHNSLIGTKGRLIRSIMEECGGVHIHFPVEGSGSDTV
V
IRGPSSDVEKAKKQLLHLAEEK
QTKSFTVDIRAKPEYHKFLIGKGGGKIRKVRDSTGARIIFPAAEDKD
Q
DLITIIGKEDAVREAQKELEALIQNL
ENVVEDYMLVDPKHHRHFVIRRGQVLREIAEEYGGVMVSFPRS
G
TQSDKVTLKGAKDCVEAAKKRIQEIIEDL
EAQVTVECAIPQKFHRSVMGPKGSRIQQITRDYNVQIKFP
D
REENP
VHSVEPSIQENGDEAGEGREAKETDPGSPRRCDIIIISGRKEKCEAAKEALEALVPVTIEVEVP
F
DLHRYIIGQKGSGIRKMMDEFE
VNIHVPAPELQSDTIAITGLAANLDRAKAGLLDRVKELQAEQEDRAL
R
SFKLSVTVDPKYHPKIIGRKGAVITQIRLEHEVNIQFPDKDDGNQ
PQDQITITGYEKNTEAARDAILKI
V
GELEQMVSEDVPLDHRVHARIIGARGKAIRKIMDEFK
VDIRFPQSGAPDPNCVTVTGLPENVEEAIDHI
L
NLEEEY
LADVVDSEALQVYMKPPAHEESRAPSKGFVVRDAPWTSNSSEKAPDMSSSEEFPSFGAQVAPK
T
LPWGPKR




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser