NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS15144.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
15144.1 Public Mus musculus 1 Hjurp 21 106 86 CCDS HistoryNCBI Gene:381280Re-query CCDS DB by CCDS ID:15144.1Re-query CCDS DB by GeneID:381280See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 15144.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000054674 ENSMUSP00000054263 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000054674Link to Ensembl Protein Viewer:ENSMUSP00000054263Re-query CCDS DB by Nucleotide ID:ENSMUST00000054674Re-query CCDS DB by Protein ID:ENSMUSP00000054263
Original member Current member EBI,WTSI OTTMUST00000049209 OTTMUSP00000022762 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000049209Link to Vega Protein Viewer:OTTMUSP00000022762Re-query CCDS DB by Nucleotide ID:OTTMUST00000049209Re-query CCDS DB by Protein ID:OTTMUSP00000022762
Original member Current member NCBI NM_198652.2 NP_941054.2 Accepted alive Link to Nucleotide Sequence:NM_198652.2Link to Protein Sequence:NP_941054.2Re-query CCDS DB by Nucleotide ID:NM_198652Re-query CCDS DB by Protein ID:NP_941054Link to BLAST:NP_941054.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_941054.2 667 Q6PG16-1 667 99.8501% 0 1

Chromosomal Locations for CCDS 15144.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 1 (NC_000067.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 88265181 88266658 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 88267948 88268026 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 88269321 88269413 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 88270202 88270299 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 88272729 88272765 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 88275042 88275097 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 88277219 88277285 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 88277374 88277469 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2004 nt):
ATGGAGTCTATGGGTCGGCAGGACCGCAGGCTGCATCAGCAGCTTAAGGAAAGCAGTAGCCGCTTCCAGA
CG
TTAATGAAGCGGCTGATAGCGAAGTACAACCAGCCCTTTGAGGACGACCCGTTGGTGGAGATGAGGAC
G
TTAACCTACGAGACGCCCCAGGGGTTGAGAGTTTGGGGAGGAAAGCTGATGAAGAAGGAAGACAAGGAA
TAC
ACTCAGGTGATTGACAGATTAAATGGGCAAGCTCCAGAAGGTGATTCAGAGAGCAGCGGTGCGGATA
CG
AGCTTAGAGGAGAACTGGCCATCTTGCAGCTCAGCGATGAGAGAAGCCTCTGGTGATCCTAGGCAGCG
T
CAGCCTGCAGTGCCCGGAAACACCTTGGAAACTGATTTAAGAAGGAAGTACTTGACCCAGGTGGATATA
TTG
CCTCAAGATGAAGAGTATTTTAAGAACGCAGAGAAGAGAGGTGGAAAAGACACAGTCATGACTTGGG
TT
CCTTCCGTGACCTCATCTGTCACACCAGCCTCTGGATGCCAGGATGCTATCTCTGCAAAGAGCTCTGG
T
GGTCCTGAAGTATCTGCTTTGTCCTCTAGAGGCCAGGGTCCCTCATACCCTTGCCCAGCTGATATGGCC
ATT
GTGGCTAGAAGTGATGGCCTCTCCTTACTTGGGACCAGCAGCAACAGCGTAAGCAGCCAGTCCTTTG
AG
GTTGATGACCTTTGCAATGTGACAATCAGCGATTTGTATGAAGGCATGATGCATTCCATGAGTAGGCT
G
CTGCGCTCAAAGCCATCCTGCATCATCTCCACCAAGACCTACATCAACCAGAGCTGGAAGCTCCGGAGG
AGA
CCCTCACGCAAGCAGGGGCTGCACAAGAACAGGACACACTGCCCCCGGAGCAAGCCCTCCCAGAGGA
GT
GCCAGGAAGGGGCCTGCGTCCTGCTCAGAGCCCGGGAAAGAGGCCGGAATATTAAGAGACTACGGGAA
T
TTACTGCACGTTGCTCCCCACAAGACAGGCTTAGAACTGAAAAGCGTTTCTCTTGAAGGAAGCAAACGC
CAA
GTCCATAAATCCAGTCCAGCTTGGAAGGAGCTCCAGATGATGCCGCAGAAGGACTTGGACTTAAACC
GT
GAGCGAGAAAATAGGGTGATGACATTACAGTGGCTAATTTCACCCGTCAAGGTGGTTCCCAGACCAAG
G
ATGCTTCCAAGTCAAGTAGAGAAGTGGTATAGAGAGATTAAAATCAAATTTGACAAGCTTCATCAGGAA
TAT
TGCCTGTCTTCTGGGAAACAGCCTCGCCTGACTGACCCCACAGAGTCTTGGGCTGTCGATGTGTACA
GA
AGTGGTTCTAAGAGCCCAGGCAGCCGTCAGGATGTAGAAACCTGCAGGCCCAGTTCACCTTTCGGCAG
A
GAAAAGACAGAAAGGCCAGGTGAAGCTTTAGAAGACCTGAGGGGAAATGGAAAGTCTGTCAAAACAAAG
AGC
TGTCTTCTAAGGAGCTGTCCCTCTCCAGAGGGCAGCCCGTCACGGAGCCCCAGCCATTCTCAGCTGA
GC
TCTGGCCTTCAAGAGCACAATTCTGAACCTACTGGTAAGGCAGTGTGGCCCAGTACAGCTATTTCAGC
A
CCAAGCATAGGCTCTCCAGGCTGTGGGAAGGATAACTATGATGAGCTTAAAAAAGAATTCAACAGACTT
TAT
CAGAAGTATTGTCTGTCACCGCAGCGGGCGAAGGTGACTTCGTGTGGCAGAGTATCGCCAATGAAAG
CT
GCTGCAGCTCTTCCCTGTCAATCAGAGCACTTGAAGAGACTAAATCCAGACTCCCCACAACAGAGTTC
C
CAGAAACGGTCAATCTCTCCTGGCTGTCACAGAAGAGTCCTGCAGGATTCAACTGCACAGACTGCTAGT
ACA
CTTGTGAGAGACTCTTGGCTGCCAACAAAGAGGTGCAAGTTGTCATACCCGGTAGCTTGTGCTCACC
AG
GCCAAGTTTCACGATACCTCAGGAGCATCAGGCTGGCCCTGA


Translation (667 aa):
MESMGRQDRRLHQQLKESSSRFQTLMKRLIAKYNQPFEDDPLVEMRTLTYETPQGLRVWGGKLMKKEDKE
Y
TQ
VIDRLNGQAPEGDSESSGADTSLEENWPSCSSAMREASGDPRQRQPAVPGNTLETDLRRKYLTQVDI
L
PQDEEYFK
NAEKRGGKDTVMTWVPSVTSSVTPASGCQDAISAKSSGGPEVSALSSRGQGPSYPCPADMA
I
VARSDGLSLLGTSSNSVSSQSFEVDDLCNVTISDLYEGMMHSMSRLLRSKPSCIISTKTYINQSWKLRR
R
PSRKQGLHKNRTHCPRSKPSQRSARKGPASCSEPGKEAGILRDYGNLLHVAPHKTGLELKSVSLEGSKR
Q
VHKSSPAWKELQMMPQKDLDLNRERENRVMTLQWLISPVKVVPRPRMLPSQVEKWYREIKIKFDKLHQE
Y
CLSSGKQPRLTDPTESWAVDVYRSGSKSPGSRQDVETCRPSSPFGREKTERPGEALEDLRGNGKSVKTK
S
CLLRSCPSPEGSPSRSPSHSQLSSGLQEHNSEPTGKAVWPSTAISAPSIGSPGCGKDNYDELKKEFNRL
Y
QKYCLSPQRAKVTSCGRVSPMKAAAALPCQSEHLKRLNPDSPQQSSQKRSISPGCHRRVLQDSTAQTAS
T
LVRDSWLPTKRCKLSYPVACAHQAKFHDTSGASGWP




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser