NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS14488.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
14488.1 Public Homo sapiens X ARMCX6 22 109 92 CCDS HistoryNCBI Gene:54470Re-query CCDS DB by CCDS ID:14488.1Re-query CCDS DB by GeneID:54470See the combined annotation on chromosome X in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 14488.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000361910.8 ENSP00000354708.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000361910.8Link to Ensembl Protein Viewer:ENSP00000354708.4Re-query CCDS DB by Nucleotide ID:ENST00000361910Re-query CCDS DB by Protein ID:ENSP00000354708
Original member Current member EBI,WTSI ENST00000538627.5 ENSP00000440648.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000538627.5Link to Ensembl Protein Viewer:ENSP00000440648.1Re-query CCDS DB by Nucleotide ID:ENST00000538627Re-query CCDS DB by Protein ID:ENSP00000440648
Original member Current member EBI,WTSI ENST00000539247.5 ENSP00000444537.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000539247.5Link to Ensembl Protein Viewer:ENSP00000444537.1Re-query CCDS DB by Nucleotide ID:ENST00000539247Re-query CCDS DB by Protein ID:ENSP00000444537
Original member Current member NCBI NM_001009584.1 NP_001009584.1 Accepted alive Link to Nucleotide Sequence:NM_001009584.1Link to Protein Sequence:NP_001009584.1Re-query CCDS DB by Nucleotide ID:NM_001009584Re-query CCDS DB by Protein ID:NP_001009584Link to BLAST:NP_001009584.1
Original member Current member NCBI NM_001184768.1 NP_001171697.1 Accepted alive Link to Nucleotide Sequence:NM_001184768.1Link to Protein Sequence:NP_001171697.1Re-query CCDS DB by Nucleotide ID:NM_001184768Re-query CCDS DB by Protein ID:NP_001171697Link to BLAST:NP_001171697.1
Original member Current member NCBI NM_019007.3 NP_061880.2 Accepted alive Link to Nucleotide Sequence:NM_019007.3Link to Protein Sequence:NP_061880.2Re-query CCDS DB by Nucleotide ID:NM_019007Re-query CCDS DB by Protein ID:NP_061880Link to BLAST:NP_061880.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001009584.1 300 Q7L4S7 300 100% 0 0
NP_001171697.1 300 Q7L4S7 300 100% 0 0
NP_061880.2 300 Q7L4S7 300 100% 0 0

Chromosomal Locations for CCDS 14488.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome X (NC_000023.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XSee the combined annotation on chromosome X in Sequence Viewer

Chromosome Start Stop Links
X 101615718 101616620 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (903 nt):
ATGGGCCGGGCTCGGGAAGTGGGTTGGATGGCGGCAGGACTGATGATTGGGGCTGGTGCCTGCTACTGCG
TT
TACAAACTGACCATAGGAAGAGATGACAGTGAGAAGCTGGAGGAGGAGGGGGAAGAGGAGTGGGACGA
T
GACCAGGAGCTGGATGAGGAGGAGCCTGATATTTGGTTTGATTTTGAAACTATGGCTCGGCCCTGGACT
GAG
GATGGGGATTGGACTGAACCTGGGGCCCCAGGTGGCACTGAGGACAGGCCCTCAGGGGGAGGCAAGG
CC
AACCGAGCACACCCAATAAAACAGCGGCCATTCCCCTATGAACATAAAAATACTTGGAGTGCTCAAAA
T
TGTAAAAATGGCAGTTGTGTTCTGGACCTCTCCAAGTGTCTTTTCATTCAGGGAAAACTGTTGTTTGCC
GAG
CCCAAGGATGCGGGCTTTCCATTTAGCCAGGATATCAATAGCCATTTGGCCAGCCTCTCAATGGCTA
GA
AACACGAGCCCCACTCCAGACCCCACTGTTAGAGAGGCTTTGTGTGCCCCGGATAACTTAAATGCGAG
T
ATTGAAAGTCAGGGCCAGATTAAGATGTACATCAATGAAGTGTGTCGGGAGACTGTGTCACGTTGCTGC
AAC
TCATTTCTGCAGCAGGCCGGATTAAATTTGTTAATAAGCATGACAGTTATTAATAACATGCTTGCCA
AG
TCCGCTTCAGACTTGAAGTTTCCTTTGATATCAGAGGGAAGTGGATGTGCTAAGGTTCAGGTTTTGAA
A
CCGCTGATGGGTTTGTCTGAAAAGCCAGTCTTGGCGGGGGAGTTAGTCGGTGCCCAGATGCTCTTCTCA
TTC
ATGTCCCTCTTTATCAGAAATGGAAACAGAGAGATTCTCCTGGAAACCCCTGCCCCATAA


Translation (300 aa):
MGRAREVGWMAAGLMIGAGACYCVYKLTIGRDDSEKLEEEGEEEWDDDQELDEEEPDIWFDFETMARPWT
E
DGDWTEPGAPGGTEDRPSGGGKANRAHPIKQRPFPYEHKNTWSAQNCKNGSCVLDLSKCLFIQGKLLFA
E
PKDAGFPFSQDINSHLASLSMARNTSPTPDPTVREALCAPDNLNASIESQGQIKMYINEVCRETVSRCC
N
SFLQQAGLNLLISMTVINNMLAKSASDLKFPLISEGSGCAKVQVLKPLMGLSEKPVLAGELVGAQMLFS
F
MSLFIRNGNREILLETPAP




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser