NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS1442.2 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
1442.2 Public Homo sapiens 1 ETNK2 22 109 92 CCDS HistoryNCBI Gene:55224Re-query CCDS DB by CCDS ID:1442.2Re-query CCDS DB by GeneID:55224See the combined annotation on chromosome 1 in Sequence Viewer

Public Note for CCDS 1442.1
The coding region has been updated to represent an alternative 3' splice pattern, resulting in a distinct C-terminus that is better supported by available transcript and homology data.

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)

Sequence IDs included in CCDS 1442.2

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000367202.8 ENSP00000356170.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000367202.8Link to Ensembl Protein Viewer:ENSP00000356170.4Re-query CCDS DB by Nucleotide ID:ENST00000367202Re-query CCDS DB by Protein ID:ENSP00000356170
Original member NCBI NM_018208.3 NP_060678.2 Updated not alive Link to Nucleotide Sequence:NM_018208.3Link to Protein Sequence:NP_060678.2Re-query CCDS DB by Nucleotide ID:NM_018208Re-query CCDS DB by Protein ID:NP_060678
Current member NCBI NM_018208.4 NP_060678.2 Accepted alive Link to Nucleotide Sequence:NM_018208.4Link to Protein Sequence:NP_060678.2Re-query CCDS DB by Nucleotide ID:NM_018208Re-query CCDS DB by Protein ID:NP_060678Link to BLAST:NP_060678.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_060678.2 386 Q9NVF9-1 386 100% 0 0

Chromosomal Locations for CCDS 1442.2

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 1 (NC_000001.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 204132184 204132256 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 204134515 204134588 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 204137104 204137249 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 204140035 204140118 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 204141315 204141457 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 204146642 204146764 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 204149703 204149962 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 204151595 204151852 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1161 nt):
ATGGCTGTGCCCCCTTCGGCCCCTCAGCCGCGCGCGTCCTTTCACCTGAGGAGGCACACGCCTTGCCCGC
AG
TGCTCATGGGGCATGGAGGAGAAGGCGGCGGCCAGCGCCAGCTGCCGGGAGCCGCCGGGCCCCCCGAG
G
GCCGCCGCCGTCGCGTACTTCGGCATTTCCGTGGACCCGGACGACATCCTTCCCGGGGCCCTGCGCCTC
ATC
CAGGAGCTGCGGCCGCATTGGAAACCCGAGCAAGTTCGGACCAAGCGCTTCACGGATGGCATCACCA
AC
AAGCTGGTGGCCTGCTATGTGGAGGAGGACATGCAGGACTGCGTGCTGGTCCGGGTGTATGGGGAGCG
G
ACGGAGCTGCTGGTGGACCGGGAGAATGAGGTCAGAAACTTCCAGCTGCTGCGAGCACACAGCTGTGCC
CCC
AAACTCTACTGCACCTTCCAGAATGGGCTGTGCTATGAGTACATGCAGGGTGTGGCCCTGGAGCCTG
AG
CACATCCGTGAGCCCCGGCTTTTCAGGTTAATCGCCTTAGAAATGGCAAAGATTCATACTATCCACGC
C
AACGGCAGCCTGCCCAAGCCCATCCTCTGGCACAAGATGCACAATTATTTCACGCTTGTGAAGAACGAG
ATC
AACCCCAGCCTTTCTGCAGATGTCCCTAAGGTAGAGGTGTTGGAACGGGAGCTGGCCTGGCTGAAGG
AG
CATCTGTCCCAGCTGGAGTCCCCTGTGGTGTTTTGTCACAATGACCTGCTCTGCAAGAATATCATCTA
T
GACAGCATCAAAGGTCACGTGCGGTTCATTGACTATGAATATGCTGGCTACAACTACCAAGCTTTTGAC
ATT
GGCAACCATTTCAATGAGTTTGCAGGCGTGAATGAGGTGGATTACTGCCTGTACCCGGCGCGGGAGA
CC
CAGCTGCAGTGGCTGCACTACTACCTGCAGGCACAAAAGGGGATGGCCGTGACCCCCAGGGAGGTGCA
A
AGGCTCTACGTGCAAGTCAACAAGTTTGCCCTGGCGTCTCACTTCTTCTGGGCTCTCTGGGCCCTCATC
CAG
AACCAGTACTCCACCATCGACTTTGATTTCCTCAGGTACGCAGTGATCCGATTCAACCAGTACTTCA
AG
GTGAAGCCTCAAGCGTCAGCCTTGGAGATGCCAAAGTGA


Translation (386 aa):
MAVPPSAPQPRASFHLRRHTPCPQCSWGMEEKAAASASCREPPGPPRAAAVAYFGISVDPDDILPGALRL
I
QELRPHWKPEQVRTK
RFTDGITNKLVACYVEEDMQDCVLVRVYGERTELLVDRENEVRNFQLLRAHSCA
P
KLYCTFQNGLCYEYMQGVALEPEHIREPRLF
RLIALEMAKIHTIHANGSLPKPILWHKMHNYFTLVKNE
I
NP
SLSADVPKVEVLERELAWLKEHLSQLESPVVFCHNDLLCKNIIYDSIKGHVRFIDYEYAGYNYQAFD
I
GNHFNEFA
GVNEVDYCLYPARETQLQWLHYYLQAQKGMAVTPREVQRLYVQVNKFALASHFFWALWALI
Q
NQYSTIDFDFL
RYAVIRFNQYFKVKPQASALEMPK



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser