NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS14190.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
14190.1 Public Homo sapiens X PHKA2 22 109 92 CCDS HistoryNCBI Gene:5256Re-query CCDS DB by CCDS ID:14190.1Re-query CCDS DB by GeneID:5256See the combined annotation on chromosome X in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 14190.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000379942.4 ENSP00000369274.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000379942.4Link to Ensembl Protein Viewer:ENSP00000369274.4Re-query CCDS DB by Nucleotide ID:ENST00000379942Re-query CCDS DB by Protein ID:ENSP00000369274
Original member NCBI NM_000292.2 NP_000283.1 Updated not alive Link to Nucleotide Sequence:NM_000292.2Link to Protein Sequence:NP_000283.1Re-query CCDS DB by Nucleotide ID:NM_000292Re-query CCDS DB by Protein ID:NP_000283
Current member NCBI NM_000292.3 NP_000283.1 Accepted alive Link to Nucleotide Sequence:NM_000292.3Link to Protein Sequence:NP_000283.1Re-query CCDS DB by Nucleotide ID:NM_000292Re-query CCDS DB by Protein ID:NP_000283Link to BLAST:NP_000283.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_000283.1 1235 P46019 1235 100% 0 0

Chromosomal Locations for CCDS 14190.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome X (NC_000023.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XSee the combined annotation on chromosome X in Sequence Viewer

Chromosome Start Stop Links
X 18893485 18893655 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 18894204 18894404 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 18895138 18895191 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 18897163 18897333 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 18899173 18899226 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 18900670 18900699 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 18901485 18901603 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 18905758 18905859 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 18906495 18906624 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 18906736 18906814 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 18907018 18907097 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 18907900 18908056 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 18908801 18908934 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 18910872 18910960 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 18918681 18918854 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 18920032 18920201 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 18924056 18924134 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 18924381 18924525 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 18925668 18925777 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 18926453 18926587 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 18929228 18929306 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 18931641 18931748 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 18936055 18936150 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 18938627 18938749 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 18939995 18940048 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 18941529 18941675 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 18943710 18943808 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 18945078 18945158 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 18948744 18948826 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 18951104 18951272 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 18952494 18952541 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 18954254 18954412 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 18983855 18983932 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3708 nt):
ATGCGGAGCAGGAGCAATTCCGGGGTCCGCTTGGACGGGTACGCGCGGCTGGTGCAGCAAACCATCCTGT
GT
TACCAGAATCCCGTCACGGGGCTGCTGTCAGCCAGCCATGAGCAGAAGGATGCCTGGGTGCGGGATAA
C
ATCTACAGTATCCTGGCCGTGTGGGGCCTGGGCATGGCCTACCGTAAGAATGCAGACCGCGATGAGGAC
AAG
GCCAAGGCCTACGAGCTGGAGCAGAACGTGGTGAAGCTGATGCGAGGTCTTCTCCAGTGCATGATGA
GA
CAGGTGGCCAAAGTGGAGAAGTTCAAACACACTCAGAGCACCAAGGACAGCCTGCACGCCAAGTACAA
C
ACCGCCACCTGTGGCACGGTGGTGGGCGACGACCAGTGGGGCCACCTCCAGGTGGATGCCACCTCTCTC
TTC
CTCCTGTTCCTGGCCCAGATGACCGCCTCAGGCTTACGTATCATTTTCACTCTCGATGAGGTGGCCT
TC
ATACAGAATCTTGTCTTTTACATAGAAGCTGCATATAAAGTCGCTGATTATGGAATGTGGGAGCGTGG
A
GATAAGACTAATCAGGGCATCCCGGAATTGAATGCAAGCTCCGTAGGAATGGCCAAGGCAGCTCTTGAG
GCA
ATTGATGAACTGGACCTTTTTGGAGCCCATGGAGGACGCAAGTCAGTGATTCATGTTCTGCCAGATG
AG
GTCGAGCACTGCCAGTCTATTCTGTTCTCCATGCTGCCAAGAGCGTCGACATCTAAAGAAATTGATGC
T
GGACTTCTTTCCATTATTTCCTTCCCGGCCTTTGCAGTGGAAGATGTAAACCTTGTAAATGTGACCAAA
AAT
GAAATTATTTCTAAGCTCCAGGGGCGTTATGGATGCTGTCGCTTCCTTCGAGATGGTTATAAAACTC
CA
AGAGAGGACCCTAATCGACTGCATTATGACCCTGCTGAACTCAAGCTCTTCGAAAACATTGAATGTGA
G
TGGCCTGTGTTTTGGACATATTTTATAATAGATGGAGTCTTCAGTGGTGATGCTGTTCAGGTCCAAGAA
TAC
CGAGAGGCCCTGGAGGGAATACTCATCAGAGGCAAGAATGGGATCCGCCTGGTGCCTGAACTCTACG
CT
GTCCCGCCTAACAAGGTAGATGAAGAGTACAAGAATCCTCACACAGTAGACCGAGTTCCTATGGGGAA
G
GTGCCTCATCTGTGGGGCCAATCCTTGTACATCCTCAGCTCGCTGTTGGCAGAGGGATTCCTTGCCGCT
GGT
GAAATCGATCCCTTAAATAGAAGATTTTCCACTTCAGTCAAACCTGATGTTGTAGTACAAGTTACTG
TT
TTGGCAGAAAACAATCACATTAAGGACTTATTGAGGAAACACGGGGTGAACGTCCAGAGTATCGCGGA
C
ATTCATCCAATTCAAGTCCAGCCGGGCCGGATTCTTAGTCACATATATGCCAAGCTTGGACGGAATAAG
AAT
ATGAATTTGAGTGGGCGACCGTATCGACATATTGGTGTCCTTGGAACCTCTAAACTATATGTGATTA
GG
AACCAAATCTTTACTTTTACACCCCAGTTCACCGACCAGCATCACTTCTACCTGGCCCTCGACAATGA
G
ATGATCGTGGAGATGCTAAGGATCGAGCTGGCCTACCTGTGCACCTGCTGGAGGATGACGGGCAGACCC
ACA
CTCACCTTCCCCATCAGTCGCACCATGCTCACAAATGATGGCTCAGACATTCATTCTGCTGTGCTCT
CC
ACAATTAGAAAACTAGAGGATGGATATTTTGGAGGAGCCAGAGTAAAATTAGGGAACCTTTCGGAATT
T
CTCACCACATCGTTCTACACATATCTGACTTTTCTGGATCCAGACTGTGATGAGAAGTTGTTTGACAAT
GCC
AGCGAAGGGACTTTCAGTCCTGATAGTGATTCAGATTTGGTAGGATATCTGGAAGACACCTGTAATC
AA
GAAAGCCAAGACGAACTTGACCATTATATCAACCACCTTCTGCAAAGCACATCGTTGAGGTCCTATCT
G
CCTCCTCTTTGTAAGAACACAGAAGACCGCCATGTCTTCAGTGCTATCCACTCCACGCGGGACATACTT
TCT
GTGATGGCAAAAGCAAAGGGTTTGGAAGTTCCATTTGTTCCCATGACTTTGCCGACTAAAGTTCTAA
GT
GCCCACCGTAAATCACTGAATCTTGTTGATTCTCCTCAGCCACTCCTAGAAAAGGTTCCTGAAAGTGA
C
TTTCAGTGGCCCAGAGATGACCATGGTGACGTGGACTGTGAGAAGCTGGTTGAGCAGCTAAAAGATTGT
TCG
AACCTACAGGACCAAGCAGACATTCTGTACATTCTTTATGTCATAAAGGGTCCCAGCTGGGACACAA
AT
CTCTCTGGACAGCACGGGGTCACCGTTCAAAACCTTCTTGGTGAGCTCTATGGGAAAGCCGGCTTGAA
C
CAGGAGTGGGGTCTGATTCGCTACATCTCAGGCCTTCTCAGGAAGAAAGTGGAGGTCCTGGCTGAGGCC
TGC
ACAGACCTGCTTTCGCACCAGAAGCAGCTCACCGTGGGCCTGCCGCCCGAGCCCCGGGAGAAGATCA
TC
TCTGCGCCCCTTCCCCCAGAGGAGCTCACAAAACTCATCTACGAGGCCAGTGGGCAGGACATCAGCAT
T
GCCGTCCTCACGCAGGAGATTGTGGTTTACCTGGCCATGTATGTCAGGGCGCAGCCCAGCCTCTTTGTG
GAG
ATGCTGAGACTCCGGATTGGACTGATCATTCAGGTGATGGCCACGGAGCTGGCACGGAGCCTGAACT
GC
TCAGGAGAAGAGGCTTCTGAAAGTTTGATGAACCTCAGCCCTTTCGATATGAAAAATCTCCTGCACCA
T
ATTCTAAGTGGGAAAGAGTTTGGCGTTGAAAGAAGTGTGCGCCCTATCCACTCCTCCACATCCAGCCCT
ACC
ATCTCCATCCACGAGGTGGGCCATACCGGAGTCACCAAAACTGAGAGGAGTGGCATTAACAGACTGA
GG
AGTGAAATGAAACAGATGACTAGGCGGTTTAGTGCTGATGAACAGTTCTTTTCTGTGGGCCAGGCCGC
G
TCCAGCAGTGCGCATTCCTCCAAGTCTGCGAGGTCCAGCACCCCATCCTCGCCCACTGGCACGTCATCC
TCA
GACTCGGGAGGACATCACATCGGCTGGGGTGAGCGGCAGGGCCAGTGGCTGCGCAGGAGAAGGCTGG
AT
GGGGCCATCAACAGGGTCCCCGTGGGATTCTACCAGAGGGTGTGGAAGATCCTCCAGAAGTGCCACGG
T
CTCTCCATCGATGGTTATGTCCTCCCATCCTCGACGACCCGAGAGATGACCCCGCATGAGATCAAGTTT
GCT
GTCCATGTCGAATCGGTGCTGAACCGCGTGCCGCAGCCCGAGTACCGGCAGCTGCTGGTGGAAGCCA
TC
ATGGTGCTGACGCTGCTCTCGGACACGGAGATGACCAGCATCGGGGGCATCATCCACGTGGACCAGAT
C
GTGCAGATGGCCAGTCAGCTGTTCTTGCAGGACCAGGTGTCAATTGGTGCCATGGACACCCTGGAGAAA
GAC
CAAGCCACAGGAATCTGCCACTTCTTTTATGACAGCGCTCCGAGTGGGGCTTATGGGACGATGACCT
AC
CTAACAAGAGCAGTGGCTTCTTATTTGCAGGAATTGTTGCCCAATTCGGGCTGCCAGATGCAATAG


Translation (1235 aa):
MRSRSNSGVRLDGYARLVQQTILCYQNPVTGLLSASHEQKDAWVRDNIYSILAVWGLGMAYRKNADRDED
K
AKAYELEQ
NVVKLMRGLLQCMMRQVAKVEKFKHTQSTKDSLHAKYNTATCGTVVGDDQWGHLQVDATSL
F
LLFLAQMTAS
GLRIIFTLDEVAFIQNLVFYIEAAYKVADYGMWERGDKTNQGIPELNASSVGMAKAALE
A
IDELDLFGAHGGRKSVIHVLPDEVEHCQ
SILFSMLPRASTSKEIDAGLLSIISFPAFAVEDVNLVNVTK
N
EIISKLQ
GRYGCCRFLRDGYKTPREDPNRLHYDPAELKLFENIECEWPVFWTYFIIDGVFSGDAVQVQE
Y
REALEGILIRGKNGIRLVPELYAVPPNK
VDEEYKNPHTVDRVPMGKVPHLWGQSLYILSSLLAEGFLAA
G
EIDPLNRRFSTSVKPDVVVQ
VTVLAENNHIKDLLRKHGVNVQSIADIHPIQVQPGRILSHIYAKLGRNK
N
MNLSGRPYRHIGVLGTSKLYVIRNQIFTFTPQ
FTDQHHFYLALDNEMIVEMLRIELAYLCTCWRMTGRP
T
LTFPISRTML
TNDGSDIHSAVLSTIRKLEDGYFGGARVKLGNLSEFLTTSFYTYLTFLDPDCDEKLFDN
A
SEGTFSPDSDSDLVGYLEDTCNQ
ESQDELDHYINHLLQSTSLRSYLPPLCKNTEDRHVFSAIHSTRDIL
S
VMAKAKGLEVP
FVPMTLPTKVLSAHRKSLNLVDSPQPLLEKVPESDFQWPRDDHGDVDCEKLVEQLKDC
S
NLQDQADILYILYVI
KGPSWDTNLSGQHGVTVQNLLGELYGKAGLNQEWGLIRYISGLLRKKVEVLAEA
C
TDLLSHQKQLTVGLPPEPREKIIS
APLPPEELTKLIYEASGQDISIAVLTQEIVVYLAMYVRAQPSLFV
E
MLRLRIGLIIQVMATELARSLNCS
GEEASESLMNLSPFDMKNLLHHILSGKEFGVERSVRPIHSSTSSP
T
ISIHEVGHTGVTKTERSGINRLRSEMKQ
MTRRFSADEQFFSVGQAASSSAHSSKSARSSTPSSPTGTSS
S
DSGGHHIGWGERQGQWLRRRRLDGAINRVPVGFYQRVWKILQK
CHGLSIDGYVLPSSTTREMTPHEIKF
A
VHVESVLNRVPQPEYRQLLVEAIMVLTLLSDTEMTSIGGIIHVDQIVQMASQLFLQDQ
VSIGAMDTLEK
D
QATGICHFFYDSAPSGAYGTMTYLTRAVASYLQELLPNSGCQMQ




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser