NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS14107.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
14107.1 Public Homo sapiens XY SHOX 20 108 85 CCDS HistoryNCBI Gene:6473Re-query CCDS DB by CCDS ID:14107.1Re-query CCDS DB by GeneID:6473See the combined annotation on chromosome X in Sequence ViewerSee the combined annotation on chromosome Y in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 14107.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000381578 ENSP00000370990 Accepted alive Link to Ensembl Transcript Viewer:ENST00000381578Link to Ensembl Protein Viewer:ENSP00000370990Re-query CCDS DB by Nucleotide ID:ENST00000381578Re-query CCDS DB by Protein ID:ENSP00000370990
Original member Current member EBI,WTSI ENST00000554971 ENSP00000452016 Accepted alive Link to Ensembl Transcript Viewer:ENST00000554971Link to Ensembl Protein Viewer:ENSP00000452016Re-query CCDS DB by Nucleotide ID:ENST00000554971Re-query CCDS DB by Protein ID:ENSP00000452016
Original member Current member EBI,WTSI OTTHUMT00000411999 OTTHUMP00000245276 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000411999Link to Vega Protein Viewer:OTTHUMP00000245276Re-query CCDS DB by Nucleotide ID:OTTHUMT00000411999Re-query CCDS DB by Protein ID:OTTHUMP00000245276
Original member Current member NCBI NM_000451.3 NP_000442.1 Accepted alive Link to Nucleotide Sequence:NM_000451.3Link to Protein Sequence:NP_000442.1Re-query CCDS DB by Nucleotide ID:NM_000451Re-query CCDS DB by Protein ID:NP_000442Link to BLAST:NP_000442.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_000442.1 292 O15266-1 292 100% 0 0

Chromosomal Locations for CCDS 14107.1

Assembly GRCh38.p7 (GCF_000001405.33)

On '+' strand of Chromosome X (NC_000023.11) On '+' strand of Chromosome Y (NC_000024.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome XSee the combined annotation on chromosome X in Sequence Viewer Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome YLink to Ensembl Genome Browser on chromosome YLink to Vega Genome Browser on chromosome YSee the combined annotation on chromosome Y in Sequence Viewer

Chromosome Start Stop Links
X 630898 631174 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 634618 634826 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 640821 640878 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 640999 641087 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 644391 644636 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X

Chromosome Start Stop Links
Y 630898 631174 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome YLink to Ensembl Genome Browser on chromosome YLink to Vega Genome Browser on chromosome Y
Y 634618 634826 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome YLink to Ensembl Genome Browser on chromosome YLink to Vega Genome Browser on chromosome Y
Y 640821 640878 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome YLink to Ensembl Genome Browser on chromosome YLink to Vega Genome Browser on chromosome Y
Y 640999 641087 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome YLink to Ensembl Genome Browser on chromosome YLink to Vega Genome Browser on chromosome Y
Y 644391 644636 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome YLink to Ensembl Genome Browser on chromosome YLink to Vega Genome Browser on chromosome Y

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (879 nt):
ATGGAAGAGCTCACGGCTTTTGTATCCAAGTCTTTTGACCAGAAAAGCAAGGACGGTAACGGCGGAGGCG
GA
GGCGGCGGAGGTAAGAAGGATTCCATTACGTACCGGGAAGTTTTGGAGAGCGGACTGGCGCGCTCCCG
G
GAGCTGGGGACGTCGGATTCCAGCCTCCAGGACATCACGGAGGGCGGCGGCCACTGCCCGGTGCATTTG
TTC
AAGGACCACGTAGACAATGACAAGGAGAAACTGAAAGAATTCGGCACCGCGAGAGTGGCAGAAGGGA
TT
TATGAATGCAAAGAGAAGCGCGAGGACGTGAAGTCGGAGGACGAGGACGGGCAGACCAAGCTGAAACA
G
AGGCGCAGCCGCACCAACTTCACGCTGGAGCAGCTGAACGAGCTCGAGCGACTCTTCGACGAGACCCAT
TAC
CCCGACGCCTTCATGCGCGAGGAGCTCAGCCAGCGCCTGGGGCTCTCCGAGGCGCGCGTGCAGGTTT
GG
TTCCAGAACCGGAGAGCCAAGTGCCGCAAACAAGAGAATCAGATGCATAAAGGCGTCATCTTGGGCAC
A
GCCAACCACCTAGACGCCTGCCGAGTGGCACCCTACGTCAACATGGGAGCCTTACGGATGCCTTTCCAA
CAG
GTCCAGGCTCAGCTGCAGCTGGAAGGCGTGGCCCACGCGCACCCGCACCTGCACCCGCACCTGGCGG
CG
CACGCGCCCTACCTGATGTTCCCCCCGCCGCCCTTCGGGCTGCCCATCGCGTCGCTGGCCGAGTCCGC
C
TCGGCCGCCGCCGTGGTCGCCGCCGCCGCCAAAAGCAACAGCAAGAATTCCAGCATCGCCGACCTGCGG
CTC
AAGGCGCGGAAGCACGCGGAGGCCCTGGGGCTCTGA


Translation (292 aa):
MEELTAFVSKSFDQKSKDGNGGGGGGGGKKDSITYREVLESGLARSRELGTSDSSLQDITEGGGHCPVHL
F
KDHVDNDKEKLKEFGTARVAE
GIYECKEKREDVKSEDEDGQTKLKQRRSRTNFTLEQLNELERLFDETH
Y
PDAFMREELSQRLGLSEARVQ
VWFQNRRAKCRKQENQMHKGVILGTANHLDACRVAPYVNMGALRMPFQ
Q
VQAQLQLEGVAHAHPHLHPHLAAHAPYLMFPPPPFGLPIASLAESASAAAVVAAAAKSNSKNSSIADLR
L
KARKHAEALGL




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser