NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS13851.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
13851.1 Public Homo sapiens 22 EWSR1 22 109 92 CCDS HistoryNCBI Gene:2130Re-query CCDS DB by CCDS ID:13851.1Re-query CCDS DB by GeneID:2130See the combined annotation on chromosome 22 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 13851.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000397938.6 ENSP00000381031.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000397938.6Link to Ensembl Protein Viewer:ENSP00000381031.2Re-query CCDS DB by Nucleotide ID:ENST00000397938Re-query CCDS DB by Protein ID:ENSP00000381031
Original member Current member NCBI NM_005243.3 NP_005234.1 Accepted alive Link to Nucleotide Sequence:NM_005243.3Link to Protein Sequence:NP_005234.1Re-query CCDS DB by Nucleotide ID:NM_005243Re-query CCDS DB by Protein ID:NP_005234Link to BLAST:NP_005234.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_005234.1 656 Q01844-1 656 100% 0 0

Chromosomal Locations for CCDS 13851.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 22 (NC_000022.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22See the combined annotation on chromosome 22 in Sequence Viewer

Chromosome Start Stop Links
22 29268337 29268349 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 29272216 29272252 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 29272380 29272431 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 29273741 29273864 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 29278030 29278216 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 29282390 29282557 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 29286923 29287134 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 29288606 29288786 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 29291562 29291599 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 29292137 29292169 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 29292488 29292606 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 29296239 29296368 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 29297827 29297949 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 29298733 29298895 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 29299234 29299331 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 29299599 29299851 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 29300122 29300161 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1971 nt):
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCC
AG
CCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCC
C
ACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTAT
GGA
CAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATG
GC
ACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGC
A
TATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAG
GAT
GGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAG
GA
TATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACC
T
CCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAG
CAG
AACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGC
AG
CAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACA
G
AGCAGCAGCTACGGGCAGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAG
GAG
TCTGGAGGATTTTCCGGACCAGGAGAGAACCGGAGCATGAGTGGCCCTGATAACCGGGGCAGGGGAA
GA
GGGGGATTTGATCGTGGAGGCATGAGCAGAGGTGGGCGGGGAGGAGGACGCGGTGGAATGGGCAGCGC
T
GGAGAGCGAGGTGGCTTCAATAAGCCTGGTGGACCCATGGATGAAGGACCAGATCTTGATCTAGGCCCA
CCT
GTAGATCCAGATGAAGACTCTGACAACAGTGCAATTTATGTACAAGGATTAAATGACAGTGTGACTC
TA
GATGATCTGGCAGACTTCTTTAAGCAGTGTGGGGTTGTTAAGATGAACAAGAGAACTGGGCAACCCAT
G
ATCCACATCTACCTGGACAAGGAAACAGGAAAGCCCAAAGGCGATGCCACAGTGTCCTATGAAGACCCA
CCC
ACTGCCAAGGCTGCCGTGGAATGGTTTGATGGGAAAGATTTTCAAGGGAGCAAACTTAAAGTCTCCC
TT
GCTCGGAAGAAGCCTCCAATGAACAGTATGCGGGGTGGTCTGCCACCCCGTGAGGGCAGAGGCATGCC
A
CCACCACTCCGTGGAGGTCCAGGAGGCCCAGGAGGTCCTGGGGGACCCATGGGTCGCATGGGAGGCCGT
GGA
GGAGATAGAGGAGGCTTCCCTCCAAGAGGACCCCGGGGTTCCCGAGGGAACCCCTCTGGAGGAGGAA
AC
GTCCAGCACCGAGCTGGAGACTGGCAGTGTCCCAATCCGGGTTGTGGAAACCAGAACTTCGCCTGGAG
A
ACAGAGTGCAACCAGTGTAAGGCCCCAAAGCCTGAAGGCTTCCTCCCGCCACCCTTTCCGCCCCCGGGT
GGT
GATCGTGGCAGAGGTGGCCCTGGTGGCATGCGGGGAGGAAGAGGTGGCCTCATGGATCGTGGTGGTC
CC
GGTGGAATGTTCAGAGGTGGCCGTGGTGGAGACAGAGGTGGCTTCCGTGGTGGCCGGGGCATGGACCG
A
GGTGGCTTTGGTGGAGGAAGACGAGGTGGCCCTGGGGGGCCCCCTGGACCTTTGATGGAACAGATGGGA
GGA
AGAAGAGGAGGACGTGGAGGACCTGGAAAAATGGATAAAGGCGAGCACCGTCAGGAGCGCAGAGATC
GG
CCCTACTAG


Translation (656 aa):
MASTDYSTYSQAAAQQGYSAYTAQPTQGYAQTTQAYGQQSYGTYGQPTDVSYTQAQTTATYGQTAYATSY
G
QPPT
GYTTPTAPQAYSQPVQGYGTGAYDTTTATVTTTQASYAAQSAYGTQPAYPAYGQQPAATAPTRPQ
D
GNKPTETSQPQSSTGGYNQPSLGYGQSNYSYPQVPGSYPMQPVTAPPSYPPT
SYSSTQPTSYDQSSYSQ
Q
NTYGQPSSYGQQSSYGQQSSYGQQPPTSYPPQTGSYSQAPSQYSQQSSSYGQQ
SSFRQDHPSSMGVYGQ
E
SGGFSGPGENRSMSGPDNRGRGRGGFDRGGMSRGGRGGGRGGM
GSAGERGGFNKPGGPMDEGPDLDLGP
P
VDPDEDSDNSAIYVQGLNDSVTLDDLADFFKQCGVVK
MNKRTGQPMIHIYLDKETGKPKGDATVSYEDP
P
TAKAAVEWFD
GKDFQGSKLKVSLARKKPPMNSMRGGLPPREGRGMPPPLRGGPGGPGGPGGPMGRMGGR
G
GDRGGFPPRGPRGSRGNPSGGGNVQHRAGDWQCPN
PGCGNQNFAWRTECNQCKAPKPEGFLPPPFPPPG
G
DRGRGGPGGMRGGRGGLMDRGGPGGMFRGGRGGDRGGFRGGRGMDRGGFGGGRRGGPGGPPGPLMEQMG
G
RRGGRGGPGKMD
KGEHRQERRDRPY



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser