NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS13792.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
13792.1 Public Homo sapiens 22 SDF2L1 22 109 92 CCDS HistoryNCBI Gene:23753Re-query CCDS DB by CCDS ID:13792.1Re-query CCDS DB by GeneID:23753See the combined annotation on chromosome 22 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 13792.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000248958.4 ENSP00000248958.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000248958.4Link to Ensembl Protein Viewer:ENSP00000248958.4Re-query CCDS DB by Nucleotide ID:ENST00000248958Re-query CCDS DB by Protein ID:ENSP00000248958
Original member NCBI NM_022044.2 NP_071327.2 Updated not alive Link to Nucleotide Sequence:NM_022044.2Link to Protein Sequence:NP_071327.2Re-query CCDS DB by Nucleotide ID:NM_022044Re-query CCDS DB by Protein ID:NP_071327
Current member NCBI NM_022044.3 NP_071327.2 Accepted alive Link to Nucleotide Sequence:NM_022044.3Link to Protein Sequence:NP_071327.2Re-query CCDS DB by Nucleotide ID:NM_022044Re-query CCDS DB by Protein ID:NP_071327Link to BLAST:NP_071327.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_071327.2 221 Q9HCN8 221 100% 0 0

Chromosomal Locations for CCDS 13792.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 22 (NC_000022.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22See the combined annotation on chromosome 22 in Sequence Viewer

Chromosome Start Stop Links
22 21642337 21642523 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 21642862 21643058 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 21643894 21644175 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (666 nt):
ATGTGGAGCGCGGGCCGCGGCGGGGCTGCCTGGCCGGTGCTGTTGGGGCTGCTGCTGGCGCTGTTAGTGC
CG
GGCGGTGGTGCCGCCAAGACCGGTGCGGAGCTCGTGACCTGCGGGTCGGTGCTGAAGCTGCTCAATAC
G
CACCACCGCGTGCGGCTGCACTCGCACGACATCAAATACGGATCCGGCAGCGGCCAGCAATCGGTGACC
GGC
GTAGAGGCGTCGGACGACGCCAATAGCTACTGGCGGATCCGCGGCGGCTCGGAGGGCGGGTGCCCGC
GC
GGGTCCCCGGTGCGCTGCGGGCAGGCGGTGAGGCTCACGCATGTGCTTACGGGCAAGAACCTGCACAC
G
CACCACTTCCCGTCGCCGCTGTCCAACAACCAGGAGGTGAGTGCCTTTGGGGAAGACGGCGAGGGCGAC
GAC
CTGGACCTATGGACAGTGCGCTGCTCTGGACAGCACTGGGAGCGTGAGGCTGCTGTGCGCTTCCAGC
AT
GTGGGCACCTCTGTGTTCCTGTCAGTCACGGGTGAGCAGTATGGAAGCCCCATCCGTGGGCAGCATGA
G
GTCCACGGCATGCCCAGTGCCAACACGCACAATACGTGGAAGGCCATGGAAGGCATCTTCATCAAGCCT
AGT
GTGGAGCCCTCTGCAGGTCACGATGAACTCTGA


Translation (221 aa):
MWSAGRGGAAWPVLLGLLLALLVPGGGAAKTGAELVTCGSVLKLLNTHHRVRLHSHDIKYGSGSGQQSVT
G
VEASDDANSYWRIRGGSEGGCPRGSPVRCGQAVRLTHVLTGKNLHTHHFPSPLSNNQ
EVSAFGEDGEGD
D
LDLWTVRCSGQHWEREAAVRFQHVGTSVFLSVTGEQYGSPIRGQHEVHGMPSANTHNTWKAMEGIFIKP
S
VEPSAGHDEL




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser