NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS13767.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
13767.1 Public Homo sapiens 22 TBX1 20 108 85 CCDS HistoryNCBI Gene:6899Re-query CCDS DB by CCDS ID:13767.1Re-query CCDS DB by GeneID:6899See the combined annotation on chromosome 22 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 13767.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000332710 ENSP00000331791 Accepted alive Link to Ensembl Transcript Viewer:ENST00000332710Link to Ensembl Protein Viewer:ENSP00000331791Re-query CCDS DB by Nucleotide ID:ENST00000332710Re-query CCDS DB by Protein ID:ENSP00000331791
Original member Current member EBI,WTSI OTTHUMT00000318034 OTTHUMP00000197324 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000318034Link to Vega Protein Viewer:OTTHUMP00000197324Re-query CCDS DB by Nucleotide ID:OTTHUMT00000318034Re-query CCDS DB by Protein ID:OTTHUMP00000197324
Original member Current member NCBI NM_080647.1 NP_542378.1 Accepted alive Link to Nucleotide Sequence:NM_080647.1Link to Protein Sequence:NP_542378.1Re-query CCDS DB by Nucleotide ID:NM_080647Re-query CCDS DB by Protein ID:NP_542378Link to BLAST:NP_542378.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_542378.1 495 O43435-3 495 100% 0 0

Chromosomal Locations for CCDS 13767.1

Assembly GRCh38.p7 (GCF_000001405.33)

On '+' strand of Chromosome 22 (NC_000022.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22Link to Vega Genome Browser on chromosome 22See the combined annotation on chromosome 22 in Sequence Viewer

Chromosome Start Stop Links
22 19759644 19759677 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22Link to Vega Genome Browser on chromosome 22
22 19760905 19761280 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22Link to Vega Genome Browser on chromosome 22
22 19763241 19763342 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22Link to Vega Genome Browser on chromosome 22
22 19764155 19764326 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22Link to Vega Genome Browser on chromosome 22
22 19764958 19765113 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22Link to Vega Genome Browser on chromosome 22
22 19765758 19765825 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22Link to Vega Genome Browser on chromosome 22
22 19765902 19766002 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22Link to Vega Genome Browser on chromosome 22
22 19766389 19766867 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22Link to Vega Genome Browser on chromosome 22

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1488 nt):
ATGCACTTCAGCACCGTCACCAGGGACATGGAAGCCTTCACGGCCAGCAGCCTGAGCAGCCTGGGGGCCG
CG
GGGGGCTTCCCGGGCGCCGCGTCGCCCGGCGCCGACCCGTACGGCCCGCGCGAGCCCCCGCCGCCGCC
G
CCGCGCTACGACCCGTGCGCCGCCGCCGCCCCCGGCGCCCCGGGCCCGCCGCCGCCGCCGCACGCCTAC
CCG
TTTGCGCCGGCCGCCGGGGCCGCCACCAGCGCCGCCGCCGAGCCCGAGGGCCCCGGGGCCAGCTGCG
CG
GCCGCAGCCAAGGCGCCGGTGAAGAAGAACGCGAAGGTGGCCGGTGTGAGCGTGCAGCTAGAGATGAA
G
GCGCTGTGGGACGAGTTCAACCAGCTGGGCACCGAGATGATCGTCACCAAGGCCGGCAGGCGGATGTTT
CCC
ACCTTCCAAGTGAAGCTCTTCGGCATGGATCCCATGGCCGACTATATGCTGCTCATGGACTTCGTGC
CG
GTGGACGATAAGCGCTACCGGTACGCCTTCCACAGCTCCTCCTGGCTGGTGGCGGGGAAGGCCGACCC
T
GCCACGCCAGGCCGCGTGCACTACCACCCGGACTCGCCTGCCAAGGGCGCGCAGTGGATGAAGCAAATC
GTG
TCCTTCGACAAGCTCAAGCTGACCAACAACCTACTGGACGACAACGGCCACATTATTCTGAATTCCA
TG
CACAGATACCAGCCCCGCTTCCACGTGGTCTATGTGGACCCACGCAAAGATAGCGAGAAATATGCCGA
G
GAGAACTTCAAAACCTTTGTGTTCGAGGAGACACGATTCACCGCGGTCACTGCCTACCAGAACCATCGG
ATC
ACGCAGCTCAAGATTGCCAGCAATCCCTTCGCGAAAGGCTTCCGGGACTGTGACCCTGAGGACTGGC
CC
CGGAACCACCGGCCCGGCGCACTGCCGCTCATGAGCGCCTTCGCGCGCTCGCGGAACCCCGTGGCTTC
C
CCGACGCAGCCCAGCGGCACGGAGAAAGACGCGGCTGAGGCCCGGCGAGAATTCCAGCGCGACGCGGGC
GGG
CCAGCAGTGCTCGGGGACCCGGCGCATCCTCCGCAGCTGCTGGCCCGGGTGCTAAGCCCCTCGCTGC
CC
GGGGCCGGCGGCGCCGGCGGCTTAGTCCCGCTGCCCGGCGCGCCCGGAGGCCGGCCCAGTCCCCCGAA
C
CCCGAGCTGCGCCTGGAGGCGCCCGGCGCATCGGAGCCGCTGCACCACCACCCCTACAAATATCCGGCC
GCC
GCCTACGACCACTATCTCGGGGCCAAGAGCCGGCCGGCGCCCTACCCGCTGCCCGGCCTGCGTGGCC
AC
GGCTACCACCCGCACGCGCATCCGCACCACCACCACCACCCCGTGAGTCCAGCCGCCGCGGCCGCCGC
C
GCCGCTGCCGCAGCTGCCGCGGCCGCCAACATGTACTCGTCGGCCGGAGCCGCGCCGCCCGGCTCCTAC
GAC
TATTGCCCCAGATAA


Translation (495 aa):
MHFSTVTRDMEAFTASSLSSLGAAGGFPGAASPGADPYGPREPPPPPPRYDPCAAAAPGAPGPPPPPHAY
P
FAPAAGAATSAAAEPEGPGASCAAAAKAPVKKNAKVAGVSVQLEMKALWDEFNQLGTEMIVTKAG
RRMF
P
TFQVKLFGMDPMADYMLLMDFVPVDDKRY
RYAFHSSSWLVAGKADPATPGRVHYHPDSPAKGAQWMKQI
V
SFDKLKLTNNLLDDNGH
IILNSMHRYQPRFHVVYVDPRKDSEKYAEENFKTFVFEETRFTAVTAYQNHR
I
TQLKIASNPFAKGFRDCDPED
WPRNHRPGALPLMSAFARSRNPVASPTQPSGTEKDAAEARREFQRDAG
G
PAVLGDPAHPPQLLARVLSPSLPGAGGAGGLVPLPGAPGGRPSPPNPELRLEAPGASEPLHHHPYKYPA
A
AYDHYLGAKSRPAPYPLPGLRGHGYHPHAHPHHHHHPVSPAAAAAAAAAAAAAAANMYSSAGAAPPGSY
D
YCPR




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser