NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS13437.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
13437.1 Public Homo sapiens 20 NFATC2 22 109 92 CCDS HistoryNCBI Gene:4773Re-query CCDS DB by CCDS ID:13437.1Re-query CCDS DB by GeneID:4773See the combined annotation on chromosome 20 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 13437.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000396009.7 ENSP00000379330.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000396009.7Link to Ensembl Protein Viewer:ENSP00000379330.3Re-query CCDS DB by Nucleotide ID:ENST00000396009Re-query CCDS DB by Protein ID:ENSP00000379330
Original member Current member NCBI NM_173091.3 NP_775114.1 Accepted alive Link to Nucleotide Sequence:NM_173091.3Link to Protein Sequence:NP_775114.1Re-query CCDS DB by Nucleotide ID:NM_173091Re-query CCDS DB by Protein ID:NP_775114Link to BLAST:NP_775114.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_775114.1 925 Q13469-1 925 100% 0 0

Chromosomal Locations for CCDS 13437.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 20 (NC_000020.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20See the combined annotation on chromosome 20 in Sequence Viewer

Chromosome Start Stop Links
20 51391396 51391451 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 51432067 51432756 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 51435188 51435314 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 51435706 51435761 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 51454548 51454688 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 51473980 51474152 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 51475458 51475660 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 51516784 51516955 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 51523081 51524110 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 51542370 51542499 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2778 nt):
ATGAACGCCCCCGAGCGGCAGCCCCAACCCGACGGCGGGGACGCCCCAGGCCACGAGCCTGGGGGCAGCC
CC
CAAGACGAGCTTGACTTCTCCATCCTCTTCGACTATGAGTATTTGAATCCGAACGAAGAAGAGCCGAA
T
GCACATAAGGTCGCCAGCCCACCCTCCGGACCCGCATACCCCGATGATGTCCTGGACTATGGCCTCAAG
CCA
TACAGCCCCCTTGCTAGTCTCTCTGGCGAGCCCCCCGGCCGATTCGGAGAGCCGGATAGGGTAGGGC
CG
CAGAAGTTTCTGAGCGCGGCCAAGCCAGCAGGGGCCTCGGGCCTGAGCCCTCGGATCGAGATCACTCC
G
TCCCACGAACTGATCCAGGCAGTGGGGCCCCTCCGCATGAGAGACGCGGGCCTCCTGGTGGAGCAGCCG
CCC
CTGGCCGGGGTGGCCGCCAGCCCGAGGTTCACCCTGCCCGTGCCCGGCTTCGAGGGCTACCGCGAGC
CG
CTTTGCTTGAGCCCCGCTAGCAGCGGCTCCTCTGCCAGCTTCATTTCTGACACCTTCTCCCCCTACAC
C
TCGCCCTGCGTCTCGCCCAATAACGGCGGGCCCGACGACCTGTGTCCGCAGTTTCAAAACATCCCTGCT
CAT
TATTCCCCCAGAACCTCGCCAATAATGTCACCTCGAACCAGCCTCGCCGAGGACAGCTGCCTGGGCC
GC
CACTCGCCCGTGCCCCGTCCGGCCTCCCGCTCCTCATCGCCTGGTGCCAAGCGGAGGCATTCGTGCGC
C
GAGGCCTTGGTTGCCCTGCCGCCCGGAGCCTCACCCCAGCGCTCCCGGAGCCCCTCGCCGCAGCCCTCA
TCT
CACGTGGCACCCCAGGACCACGGCTCCCCGGCTGGGTACCCCCCTGTGGCTGGCTCTGCCGTGATCA
TG
GATGCCCTGAACAGCCTCGCCACGGACTCGCCTTGTGGGATCCCCCCCAAGATGTGGAAGACCAGCCC
T
GACCCCTCGCCGGTGTCTGCCGCCCCATCCAAGGCCGGCCTGCCTCGCCACATCTACCCGGCCGTGGAG
TTC
CTGGGGCCCTGCGAGCAGGGCGAGAGGAGAAACTCGGCTCCAGAATCCATCCTGCTGGTTCCGCCCA
CT
TGGCCCAAGCCGCTGGTGCCTGCCATTCCCATCTGCAGCATCCCAGTGACTGCATCCCTCCCTCCACT
T
GAGTGGCCGCTGTCCAGTCAGTCAGGCTCTTACGAGCTGCGGATCGAGGTGCAGCCCAAGCCACATCAC
CGG
GCCCACTATGAGACAGAAGGCAGCCGAGGGGCTGTCAAAGCTCCAACTGGAGGCCACCCTGTGGTTC
AG
CTCCATGGCTACATGGAAAACAAGCCTCTGGGACTTCAGATCTTCATTGGGACAGCTGATGAGCGGAT
C
CTTAAGCCGCACGCCTTCTACCAGGTGCACCGAATCACGGGGAAAACTGTCACCACCACCAGCTATGAG
AAG
ATAGTGGGCAACACCAAAGTCCTGGAGATACCCTTGGAGCCCAAAAACAACATGAGGGCAACCATCG
AC
TGTGCGGGGATCTTGAAGCTTAGAAACGCCGACATTGAGCTGCGGAAAGGCGAGACGGACATTGGAAG
A
AAGAACACGCGGGTGAGACTGGTTTTCCGAGTTCACATCCCAGAGTCCAGTGGCAGAATCGTCTCTTTA
CAG
ACTGCATCTAACCCCATCGAGTGCTCCCAGCGATCTGCTCACGAGCTGCCCATGGTTGAAAGACAAG
AC
ACAGACAGCTGCCTGGTCTATGGCGGCCAGCAAATGATCCTCACGGGGCAGAACTTTACATCCGAGTC
C
AAAGTTGTGTTTACTGAGAAGACCACAGATGGACAGCAAATTTGGGAGATGGAAGCCACGGTGGATAAG
GAC
AAGAGCCAGCCCAACATGCTTTTTGTTGAGATCCCTGAATATCGGAACAAGCATATCCGCACACCTG
TA
AAAGTGAACTTCTACGTCATCAATGGGAAGAGAAAACGAAGTCAGCCTCAGCACTTTACCTACCACCC
A
GTCCCAGCCATCAAGACGGAGCCCACGGATGAATATGACCCCACTCTGATCTGCAGCCCCACCCATGGA
GGC
CTGGGGAGCCAGCCTTACTACCCCCAGCACCCGATGGTGGCCGAGTCCCCCTCCTGCCTCGTGGCCA
CC
ATGGCTCCCTGCCAGCAGTTCCGCACGGGGCTCTCATCCCCTGACGCCCGCTACCAGCAACAGAACCC
A
GCGGCCGTACTCTACCAGCGGAGCAAGAGCCTGAGCCCCAGCCTGCTGGGCTATCAGCAGCCGGCCCTC
ATG
GCCGCCCCGCTGTCCCTTGCGGACGCTCACCGCTCTGTGCTGGTGCACGCCGGCTCCCAGGGCCAGA
GC
TCAGCCCTGCTCCACCCCTCTCCGACCAACCAGCAGGCCTCGCCTGTGATCCACTACTCACCCACCAA
C
CAGCAGCTGCGCTGCGGAAGCCACCAGGAGTTCCAGCACATCATGTACTGCGAGAATTTCGCACCAGGC
ACC
ACCAGACCTGGCCCGCCCCCGGTCAGTCAAGGTCAGAGGCTGAGCCCGGGTTCCTACCCCACAGTCA
TT
CAGCAGCAGAATGCCACGAGCCAAAGAGCCGCCAAAAACGGACCCCCGGTCAGTGACCAAAAGGAAGT
A
TTACCTGCGGGGGTGACCATTAAACAGGAGCAGAACTTGGACCAGACCTACTTGGATGATGTTAATGAA
ATT
ATCAGGAAGGAGTTTTCAGGACCTCCTGCCAGAAATCAGACGTAA


Translation (925 aa):
MNAPERQPQPDGGDAPGHEPGGSPQDELDFSILFDYEYLNPNEEEPNAHKVASPPSGPAYPDDVLDYGLK
P
YSPLASLSGEPPGRFGEPDRVGPQKFLSAAKPAGASGLSPRIEITPSHELIQAVGPLRMRDAGLLVEQP
P
LAGVAASPRFTLPVPGFEGYREPLCLSPASSGSSASFISDTFSPYTSPCVSPNNGGPDDLCPQFQNIPA
H
YSPRTSPIMSPRTSLAEDSCLGRHSPVPRPASRSSSPGAKRRHSCAEALVALPPGASPQRSRSPSPQPS
S
HVAPQDHGSPAGYPPVAGSAVIMDALNSLATDSPCGIPPKMWKTSPDPSPVSAAPSKAGLPRHIYPAVE
F
LGPCEQGERRNSAPESILLVPPTWPKPLVPAIPIC
SIPVTASLPPLEWPLSSQSGSYELRIEVQPKPHH
R
AHYETEGSRGAVKAPTGGHPVVQ
LHGYMENKPLGLQIFIGTADERILKPHAFYQVHRITGKTVTTTSYE
K
IVGNTKVLEIPLEPKNNMRA
TIDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRVHIPESSGRIVSL
Q
TASNPIEC
SQRSAHELPMVERQDTDSCLVYGGQQMILTGQNFTSESKVVFTEKTTDGQQIWEMEATVDK
D
KSQP
NMLFVEIPEYRNKHIRTPVKVNFYVINGKRKRSQPQHFTYHPVPAIKTEPTDEYDPTLICSPTHG
G
LGSQPYYPQHPMVAESPSCLVATMAPCQQFRTGLSSPDARYQQQNPAAVLYQRSKSLSPSLLGYQQPAL
M
AAPLSLADAHRSVLVHAGSQGQSSALLHPSPTNQQASPVIHYSPTNQQLRCGSHQEFQHIMYCENFAPG
T
TRPGPPPVSQGQRLSPGSYPTVIQQQNATSQRAAKNGPPVSDQKEVLPAGVTIKQEQNLDQTYLDD
VNE
I
IRKEFSGPPARNQT




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser