NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS13331.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
13331.1 Public Homo sapiens 20 HNF4A 22 109 92 CCDS HistoryNCBI Gene:3172Re-query CCDS DB by CCDS ID:13331.1Re-query CCDS DB by GeneID:3172See the combined annotation on chromosome 20 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 13331.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000443598.6 ENSP00000410911.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000443598.6Link to Ensembl Protein Viewer:ENSP00000410911.2Re-query CCDS DB by Nucleotide ID:ENST00000443598Re-query CCDS DB by Protein ID:ENSP00000410911
Original member Current member NCBI NM_178850.2 NP_849181.1 Accepted alive Link to Nucleotide Sequence:NM_178850.2Link to Protein Sequence:NP_849181.1Re-query CCDS DB by Nucleotide ID:NM_178850Re-query CCDS DB by Protein ID:NP_849181Link to BLAST:NP_849181.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_849181.1 417 P41235-3 417 100% 0 0

Chromosomal Locations for CCDS 13331.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 20 (NC_000020.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20See the combined annotation on chromosome 20 in Sequence Viewer

Chromosome Start Stop Links
20 44401373 44401487 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 44406058 44406232 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 44407381 44407475 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 44413694 44413800 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 44414507 44414662 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 44418425 44418512 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 44419721 44419876 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 44424018 44424379 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1254 nt):
ATGCGACTCTCCAAAACCCTCGTCGACATGGACATGGCCGACTACAGTGCTGCACTGGACCCAGCCTACA
CC
ACCCTGGAATTTGAGAATGTGCAGGTGTTGACGATGGGCAATGACACGTCCCCATCAGAAGGCACCAA
C
CTCAACGCGCCCAACAGCCTGGGTGTCAGCGCCCTGTGTGCCATCTGCGGGGACCGGGCCACGGGCAAA
CAC
TACGGTGCCTCGAGCTGTGACGGCTGCAAGGGCTTCTTCCGGAGGAGCGTGCGGAAGAACCACATGT
AC
TCCTGCAGATTTAGCCGGCAGTGCGTGGTGGACAAAGACAAGAGGAACCAGTGCCGCTACTGCAGGCT
C
AAGAAATGCTTCCGGGCTGGCATGAAGAAGGAAGCCGTCCAGAATGAGCGGGACCGGATCAGCACTCGA
AGG
TCAAGCTATGAGGACAGCAGCCTGCCCTCCATCAATGCGCTCCTGCAGGCGGAGGTCCTGTCCCGAC
AG
ATCACCTCCCCCGTCTCCGGGATCAACGGCGACATTCGGGCGAAGAAGATTGCCAGCATCGCAGATGT
G
TGTGAGTCCATGAAGGAGCAGCTGCTGGTTCTCGTTGAGTGGGCCAAGTACATCCCAGCTTTCTGCGAG
CTC
CCCCTGGACGACCAGGTGGCCCTGCTCAGAGCCCATGCTGGCGAGCACCTGCTGCTCGGAGCCACCA
AG
AGATCCATGGTGTTCAAGGACGTGCTGCTCCTAGGCAATGACTACATTGTCCCTCGGCACTGCCCGGA
G
CTGGCGGAGATGAGCCGGGTGTCCATACGCATCCTTGACGAGCTGGTGCTGCCCTTCCAGGAGCTGCAG
ATC
GATGACAATGAGTATGCCTACCTCAAAGCCATCATCTTCTTTGACCCAGATGCCAAGGGGCTGAGCG
AT
CCAGGGAAGATCAAGCGGCTGCGTTCCCAGGTGCAGGTGAGCTTGGAGGACTACATCAACGACCGCCA
G
TATGACTCGCGTGGCCGCTTTGGAGAGCTGCTGCTGCTGCTGCCCACCTTGCAGAGCATCACCTGGCAG
ATG
ATCGAGCAGATCCAGTTCATCAAGCTCTTCGGCATGGCCAAGATTGACAACCTGTTGCAGGAGATGC
TG
CTGGGAGGTCCGTGCCAAGCCCAGGAGGGGCGGGGTTGGAGTGGGGACTCCCCAGGAGACAGGCCTCA
C
ACAGTGAGCTCACCCCTCAGCTCCTTGGCTTCCCCACTGTGCCGCTTTGGGCAAGTTGCTTAA


Translation (417 aa):
MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGTNLNAPNSLGVSALCAICGDRATGK
H
YGASSCDGCKGFFRRSVRKNHMYSC
RFSRQCVVDKDKRNQCRYCRLKKCFRAGMKKEAVQNERDRISTR
R
SSYEDSSLPSINALLQAEVLSRQ
ITSPVSGINGDIRAKKIASIADVCESMKEQLLVLVEWAKYIPAFCE
L
PLDDQ
VALLRAHAGEHLLLGATKRSMVFKDVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLPFQELQ
I
DDNEYAYLKAIIFFDP
DAKGLSDPGKIKRLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQ
M
IEQIQFIKLFGMAKIDNLLQEMLLGGPCQAQEGRGWSGDSPGDRPHTVSSPLSSLASPLCRFGQVA




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser