NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS13320.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
13320.1 Public Homo sapiens 20 SGK2 22 109 92 CCDS HistoryNCBI Gene:10110Re-query CCDS DB by CCDS ID:13320.1Re-query CCDS DB by GeneID:10110See the combined annotation on chromosome 20 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 13320.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000341458.8 ENSP00000340608.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000341458.8Link to Ensembl Protein Viewer:ENSP00000340608.4Re-query CCDS DB by Nucleotide ID:ENST00000341458Re-query CCDS DB by Protein ID:ENSP00000340608
Original member Current member NCBI NM_016276.3 NP_057360.2 Accepted alive Link to Nucleotide Sequence:NM_016276.3Link to Protein Sequence:NP_057360.2Re-query CCDS DB by Nucleotide ID:NM_016276Re-query CCDS DB by Protein ID:NP_057360Link to BLAST:NP_057360.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_057360.2 427 Q9HBY8-1 427 100% 0 0

Chromosomal Locations for CCDS 13320.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 20 (NC_000020.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20See the combined annotation on chromosome 20 in Sequence Viewer

Chromosome Start Stop Links
20 43566316 43566531 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 43567068 43567117 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 43567665 43567722 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 43567916 43567999 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 43569385 43569516 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 43570617 43570729 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 43571024 43571060 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 43572051 43572137 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 43574909 43575004 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 43576224 43576379 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 43579972 43580061 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 43584852 43585016 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1284 nt):
ATGCAGGGGTTGCTTACCTCGGGTAGGAAACCCTCAGGCGGTGGCAGGTGCACAGGTAGGGGAGGATGGA
GA
GGGCAGTGGTGCCTGAAGCCCTGGATGGGCGGAGCTGACCCCCCAACACCAACTCTCTCATGCCTGCT
C
CTCCCTGTCCCCCCAGAGCTGCCTGATCATTGCTACAGAATGAACTCTAGCCCAGCTGGGACCCCAAGT
CCA
CAGCCCTCCAGGGCCAATGGGAACATCAACCTGGGGCCTTCAGCCAACCCAAATGCCCAGCCCACGG
AC
TTCGACTTCCTCAAAGTCATCGGCAAAGGGAACTACGGGAAGGTCCTACTGGCCAAGCGCAAGTCTGA
T
GGGGCGTTCTATGCAGTGAAGGTACTACAGAAAAAGTCCATCTTAAAGAAGAAAGAGCAGAGCCACATC
ATG
GCAGAGCGCAGTGTGCTTCTGAAGAACGTGCGGCACCCCTTCCTCGTGGGCCTGCGCTACTCCTTCC
AG
ACACCTGAGAAGCTCTACTTCGTGCTCGACTATGTCAACGGGGGAGAGCTCTTCTTCCACCTGCAGCG
G
GAGCGCCGGTTCCTGGAGCCCCGGGCCAGGTTCTACGCTGCTGAGGTGGCCAGCGCCATTGGCTACCTG
CAC
TCCCTCAACATCATTTACAGGGATCTGAAACCAGAGAACATTCTCTTGGACTGCCAGGGACACGTGG
TG
CTGACGGATTTTGGCCTCTGCAAGGAAGGTGTAGAGCCTGAAGACACCACATCCACATTCTGTGGTAC
C
CCTGAGTACTTGGCACCTGAAGTGCTTCGGAAAGAGCCTTATGATCGAGCAGTGGACTGGTGGTGCTTG
GGG
GCAGTCCTCTACGAGATGCTCCATGGCCTGCCGCCCTTCTACAGCCAAGATGTATCCCAGATGTATG
AG
AACATTCTGCACCAGCCGCTACAGATCCCCGGAGGCCGGACAGTGGCCGCCTGTGACCTCCTGCAAAG
C
CTTCTCCACAAGGACCAGAGGCAGCGGCTGGGCTCCAAAGCAGACTTTCTTGAGATTAAGAACCATGTA
TTC
TTCAGCCCCATAAACTGGGATGACCTGTACCACAAGAGGCTAACTCCACCCTTCAACCCAAATGTGA
CA
GGACCTGCTGACTTGAAGCATTTTGACCCAGAGTTCACCCAGGAAGCTGTGTCCAAGTCCATTGGCTG
T
ACCCCTGACACTGTGGCCAGCAGCTCTGGGGCCTCAAGTGCATTCCTGGGATTTTCTTATGCGCCAGAG
GAT
GATGACATCTTGGATTGCTAG


Translation (427 aa):
MQGLLTSGRKPSGGGRCTGRGGWRGQWCLKPWMGGADPPTPTLSCLLLPVPPELPDHCYRMNSSPAGTPS
P
Q
PSRANGNINLGPSANPNAQPTDFDFLKVIGKGNYGKVLLAKRKSDGAFYAVKVLQKKSILKKKEQSHI
M
AERSVLLKNVRHPFLVGLRYSFQTPEKLYFVLDYVNGGE
LFFHLQRERRFLEPRARFYAAEVASAIGYL
H
SLNIIY
RDLKPENILLDCQGHVVLTDFGLCKEGVEPEDTTSTFCGTPEYLAPEVLRKEPYDRAVDWWCL
G
AVLYEMLHGL
PPFYSQDVSQMYENILHQPLQIPGGRTVAACDLLQSLLHKDQRQRLGSKADFLEIKNHV
F
FSPINWDDLYHKRLTPPFNPNV
TGPADLKHFDPEFTQEAVSKSIGCTPDTVASSSGASSAFLGFSYAPE
D
DDILDC




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser