NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS13232.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
13232.1 Public Homo sapiens 20 ASIP 22 109 92 CCDS HistoryNCBI Gene:434Re-query CCDS DB by CCDS ID:13232.1Re-query CCDS DB by GeneID:434See the combined annotation on chromosome 20 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 13232.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000374954.3 ENSP00000364092.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000374954.3Link to Ensembl Protein Viewer:ENSP00000364092.3Re-query CCDS DB by Nucleotide ID:ENST00000374954Re-query CCDS DB by Protein ID:ENSP00000364092
Original member Current member EBI,WTSI ENST00000568305.5 ENSP00000454804.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000568305.5Link to Ensembl Protein Viewer:ENSP00000454804.1Re-query CCDS DB by Nucleotide ID:ENST00000568305Re-query CCDS DB by Protein ID:ENSP00000454804
Original member Current member NCBI NM_001672.2 NP_001663.2 Accepted alive Link to Nucleotide Sequence:NM_001672.2Link to Protein Sequence:NP_001663.2Re-query CCDS DB by Nucleotide ID:NM_001672Re-query CCDS DB by Protein ID:NP_001663Link to BLAST:NP_001663.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001663.2 132 P42127 132 100% 0 0

Chromosomal Locations for CCDS 13232.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 20 (NC_000020.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20See the combined annotation on chromosome 20 in Sequence Viewer

Chromosome Start Stop Links
20 34260375 34260534 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 34262832 34262893 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 34268991 34269167 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (399 nt):
ATGGATGTCACCCGCTTACTCCTGGCCACCCTGCTGGTCTTCCTCTGCTTCTTCACTGCCAACAGCCACC
TG
CCACCTGAGGAGAAGCTCCGAGATGACAGGAGCCTGAGAAGCAACTCCTCTGTGAACCTACTGGATGT
C
CCTTCTGTCTCTATTGTGGCGCTGAACAAGAAATCCAAACAGATCGGCAGAAAAGCAGCAGAAAAGAAA
AGA
TCTTCTAAGAAGGAGGCTTCGATGAAGAAAGTGGTGCGGCCCCGGACCCCCCTATCTGCGCCCTGCG
TG
GCCACCCGCAACAGCTGCAAGCCGCCGGCACCCGCCTGCTGCGACCCGTGCGCCTCCTGCCAGTGCCG
C
TTCTTCCGCAGCGCCTGCTCCTGCCGCGTGCTCAGCCTCAACTGCTGA


Translation (132 aa):
MDVTRLLLATLLVFLCFFTANSHLPPEEKLRDDRSLRSNSSVNLLDVPSVSIVALNKKSKQIGRKAAEKK
R
SSK
KEASMKKVVRPRTPLSAPCVATRNSCKPPAPACCDPCASCQCRFFRSACSCRVLSLNC



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser