NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS13219.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
13219.1 Public Homo sapiens 20 CDK5RAP1 22 109 92 CCDS HistoryNCBI Gene:51654Re-query CCDS DB by CCDS ID:13219.1Re-query CCDS DB by GeneID:51654See the combined annotation on chromosome 20 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 13219.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000346416.6 ENSP00000217372.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000346416.6Link to Ensembl Protein Viewer:ENSP00000217372.2Re-query CCDS DB by Nucleotide ID:ENST00000346416Re-query CCDS DB by Protein ID:ENSP00000217372
Original member Current member NCBI NM_016408.3 NP_057492.2 Accepted alive Link to Nucleotide Sequence:NM_016408.3Link to Protein Sequence:NP_057492.2Re-query CCDS DB by Nucleotide ID:NM_016408Re-query CCDS DB by Protein ID:NP_057492Link to BLAST:NP_057492.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_057492.2 587 Q96SZ6-3 587 100% 0 0

Chromosomal Locations for CCDS 13219.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 20 (NC_000020.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20See the combined annotation on chromosome 20 in Sequence Viewer

Chromosome Start Stop Links
20 33359043 33359123 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 33360351 33360491 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 33366859 33367008 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 33370499 33370629 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 33372642 33372697 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 33374115 33374212 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 33379461 33379691 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 33385650 33385770 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 33387323 33387533 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 33392142 33392242 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 33394032 33394066 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 33395013 33395116 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 33396761 33397064 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1764 nt):
ATGCACCCTTTACAGTGTGTCCTCCAAGTGCAGAGGTCTCTGGGGTGGGGACCATTGGCCTCTGTGTCTT
GG
CTGTCGCTGAGGATGTGCAGGGCACACAGCAGTCTCTCTAGTACCATGTGTCCCAGTCCAGAGAGGCA
G
GAGGATGGAGCTCGGAAGGATTTCAGCTCCAGGCTGGCTGCTGGACCGACTTTTCAACATTTTTTAAAA
AGT
GCCTCAGCTCCTCAGGAGAAGCTGTCTTCAGAAGTGGAAGACCCACCTCCCTATCTCATGATGGATG
AA
CTTCTTGGAAGGCAGAGAAAAGTCTACCTCGAGACCTATGGCTGCCAGATGAATGTGAATGACACAGA
G
ATAGCCTGGTCCATCTTACAGAAGAGTGGCTACCTGCGGACCAGTAACCTCCAAGAGGCAGATGTGATT
CTC
CTTGTCACATGCTCTATCAGGGAGAAGGCTGAGCAGACCATCTGGAACCGTTTACATCAGCTTAAAG
CC
TTGAAGACAAGGCGGCCCCGCTCCCGGGTTCCTCTGAGGATTGGAATTCTAGGCTGCATGGCTGAGAG
G
TTGAAGGAGGAGATTCTCAACAGAGAGAAAATGGTAGATATTTTGGCTGGTCCTGATGCCTACCGGGAC
CTT
CCCCGGCTGCTGGCTGTTGCTGAGTCGGGCCAGCAAGCTGCCAACGTGCTGCTCTCTCTGGACGAGA
CC
TATGCTGATGTCATGCCAGTCCAGACAAGCGCCAGTGCCACGTCTGCCTTTGTGTCAATCATGCGAGG
C
TGTGACAACATGTGTAGCTACTGCATTGTTCCTTTCACCCGGGGCAGGGAGAGGAGTCGGCCTATTGCC
TCC
ATTCTAGAGGAAGTGAAGAAGCTTTCTGAGCAGGGGCTGAAAGAAGTGACACTTCTTGGTCAGAATG
TT
AATAGTTTTCGGGACAATTCGGAGGTCCAGTTCAACAGTGCAGTGCCTACCAATCTCAGTCGTGGCTT
T
ACCACCAACTATAAAACCAAGCAAGGAGGACTTCGTTTTGCTCATCTTCTGGATCAGGTCTCCAGAGTA
GAT
CCTGAAATGAGGATCCGTTTTACCTCTCCCCACCCCAAGGATTTTCCTGATGAGGTTCTGCAGCTGA
TT
CATGAGAGAGATAACATCTGTAAACAGATCCACCTGCCAGCCCAGAGTGGAAGCAGCCGTGTGTTGGA
G
GCCATGCGGAGGGGATATTCAAGAGAAGCTTATGTGGAGTTAGTTCACCATATTAGAGAATCTATTCCA
G
GT
GTGAGCCTCAGCAGCGATTTCATTGCTGGCTTTTGTGGTGAGACGGAGGAAGATCACGTCCAGACAG
TC
TCTTTGCTCCGGGAAGTTCAGTACAACATGGGCTTCCTCTTTGCCTACAGCATGAGACAGAAGACACG
G
GCATATCATAGGCTGAAGGATGATGTCCCGGAAGAGGTAAAATTAAGGCGTTTGGAGGAACTCATCACT
ATC
TTCCGAGAAGAAGCAACAAAAGCCAATCAGACCTCTGTGGGCTGTACCCAGTTGGTGCTAGTGGAAG
GG
CTCAGTAAACGCTCTGCCACTGACCTGTGTGGCAGGAATGATGGAAACCTTAAGGTGATCTTCCCTGA
T
GCAGAGATGGAGGATGTCAATAACCCTGGGCTCAGGGTCAGAGCCCAGCCTGGGGACTATGTGCTGGTG
AAG
ATCACCTCAGCCAGTTCTCAGACACTTAGGGGACATGTTCTCTGCAGGACCACTCTGAGGGACTCTT
CT
GCATATTGCTGA


Translation (587 aa):
MHPLQCVLQVQRSLGWGPLASVSWLSLRMCRAHSSLSSTMCPSPERQEDGARKDFSSRLAAGPTFQHFLK
S
ASAPQEKLSSEVEDPPPYLMMDELLGRQRK
VYLETYGCQMNVNDTEIAWSILQKSGYLRTSNLQEADVI
L
LVTCSI
REKAEQTIWNRLHQLKALKTRRPRSRVPLRIGILGCMAERLKEEILNREKMVDILAGPDAYRD
L
PRLLAVAESGQQAANVLLSLDETYADVMPVQTSASATSAF
VSIMRGCDNMCSYCIVPFTRGRERSRPIA
S
ILEEVKKLSEQ
GLKEVTLLGQNVNSFRDNSEVQFNSAVPTNLSRGFTTNYKTKQGGLRFAHLLDQVSRV
D
PEMRIRFTSPHPKDFPDE
VLQLIHERDNICKQIHLPAQSGSSRVLEAMRRGYSREAYVELVHHIRESIP
G
VSLSSDFIAGFCGETEEDHVQTVSLLREVQYNMGFLFAYSMRQKTRAYHRLKDDVPEEVKLRRLEELIT
I
FREEATKANQTSVGCTQLVLVEG
LSKRSATDLCGRNDGNLKVIFPDAEMEDVNNPGLRVRAQPGDYVLV
K
ITSASSQTLRGHVLCRTTLRDSSAYC



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser