NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS13027.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
13027.1 Public Homo sapiens 20 SNRPB 24 110 108 CCDS HistoryNCBI Gene:6628Re-query CCDS DB by CCDS ID:13027.1Re-query CCDS DB by GeneID:6628See the combined annotation on chromosome 20 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 13027.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000381342.7 ENSP00000370746.3 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000381342.7Link to Ensembl Protein Viewer:ENSP00000370746.3Re-query CCDS DB by Nucleotide ID:ENST00000381342Re-query CCDS DB by Protein ID:ENSP00000370746
Original member Current member NCBI NM_003091.4 NP_003082.1 MANE Select Accepted alive Link to Nucleotide Sequence:NM_003091.4Link to Protein Sequence:NP_003082.1Re-query CCDS DB by Nucleotide ID:NM_003091Re-query CCDS DB by Protein ID:NP_003082Link to BLAST:NP_003082.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_003082.1 231 P14678-2 231 100% 0 0

Chromosomal Locations for CCDS 13027.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 20 (NC_000020.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20See the combined annotation on chromosome 20 in Sequence Viewer

Chromosome Start Stop Links
20 2461929 2461939 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 2462636 2462761 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 2463089 2463227 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 2463747 2463899 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 2465708 2465819 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 2467607 2467758 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 2470688 2470690 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (696 nt):
ATGACGGTGGGCAAGAGCAGCAAGATGCTGCAGCATATTGATTACAGGATGAGGTGCATCCTGCAGGACG
GC
CGGATCTTCATTGGCACCTTCAAGGCTTTTGACAAGCACATGAATTTGATCCTCTGTGACTGTGATGA
G
TTCAGAAAGATCAAGCCAAAGAACTCCAAACAAGCAGAAAGGGAAGAGAAGCGAGTCCTCGGTCTGGTG
CTG
CTGCGAGGGGAGAATCTGGTCTCAATGACAGTAGAGGGACCTCCTCCCAAAGATACTGGTATTGCTC
GA
GTTCCACTTGCTGGAGCTGCCGGGGGCCCAGGGATCGGCAGGGCTGCTGGCAGAGGAATCCCAGCTGG
G
GTTCCCATGCCCCAGGCTCCTGCAGGACTTGCTGGGCCAGTCCGTGGGGTTGGCGGGCCATCCCAACAG
GTG
ATGACCCCACAAGGAAGAGGTACTGTTGCAGCCGCTGCAGCTGCTGCCACAGCCAGTATTGCCGGGG
CT
CCAACCCAGTACCCACCTGGCCGTGGGGGTCCTCCCCCACCTATGGGCCGAGGAGCACCCCCTCCAGG
C
ATGATGGGCCCACCTCCTGGTATGAGACCTCCTATGGGTCCCCCAATGGGGATCCCCCCTGGAAGAGGG
ACT
CCAATGGGCATGCCCCCTCCGGGAATGCGGCCTCCTCCCCCTGGGATGCGAGGCCTTCTTTGA


Translation (231 aa):
MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLV
L
LRGENLVSMTVEGPPPKD
TGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQ
V
MTPQGRGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMGRGAPPP
GMMGPPPGMRPPMGPPMGIPPGRG
T
PMGMPPPGMRPPPPGMR
GLL



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser