NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS13019.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
13019.1 Public Homo sapiens 20 SIRPB1 22 109 92 CCDS HistoryNCBI Gene:10326Re-query CCDS DB by CCDS ID:13019.1Re-query CCDS DB by GeneID:10326See the combined annotation on chromosome 20 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 13019.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000381605.8 ENSP00000371018.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000381605.8Link to Ensembl Protein Viewer:ENSP00000371018.4Re-query CCDS DB by Nucleotide ID:ENST00000381605Re-query CCDS DB by Protein ID:ENSP00000371018
Original member Current member NCBI NM_006065.4 NP_006056.2 Accepted alive Link to Nucleotide Sequence:NM_006065.4Link to Protein Sequence:NP_006056.2Re-query CCDS DB by Nucleotide ID:NM_006065Re-query CCDS DB by Protein ID:NP_006056Link to BLAST:NP_006056.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_006056.2 398 O00241-1 398 100% 0 0

Chromosomal Locations for CCDS 13019.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 20 (NC_000020.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20See the combined annotation on chromosome 20 in Sequence Viewer

Chromosome Start Stop Links
20 1566155 1566267 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 1570805 1571137 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 1571720 1572037 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 1578338 1578694 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 1619869 1619944 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1197 nt):
ATGCCCGTGCCAGCCTCCTGGCCCCACCTTCCTAGTCCTTTCCTGCTGATGACGCTACTGCTGGGGAGAC
TC
ACAGGAGTGGCAGGTGAGGACGAGCTACAGGTGATTCAGCCTGAAAAGTCCGTATCAGTTGCAGCTGG
A
GAGTCGGCCACTCTGCGCTGTGCTATGACGTCCCTGATCCCTGTGGGGCCCATCATGTGGTTTAGAGGA
GCT
GGAGCAGGCCGGGAATTAATCTACAATCAGAAAGAAGGCCACTTCCCACGGGTAACAACTGTTTCAG
AA
CTCACAAAGAGAAACAACCTGGACTTTTCCATCAGCATCAGTAACATCACCCCAGCAGACGCCGGCAC
C
TACTACTGTGTGAAGTTCCGGAAAGGGAGCCCTGACGACGTGGAGTTTAAGTCTGGAGCAGGCACTGAG
CTG
TCTGTGCGCGCCAAACCCTCTGCCCCCGTGGTATCGGGCCCTGCGGTGAGGGCCACACCTGAGCACA
CA
GTGAGCTTCACCTGCGAGTCCCATGGCTTCTCTCCCAGAGACATCACCCTGAAATGGTTCAAAAATGG
G
AATGAGCTCTCAGACTTCCAGACCAACGTGGACCCCGCAGGAGACAGTGTGTCCTACAGCATCCACAGC
ACA
GCCAGGGTGGTGCTGACCCGTGGGGACGTTCACTCTCAAGTCATCTGCGAGATAGCCCACATCACCT
TG
CAGGGGGACCCTCTTCGTGGGACTGCCAACTTGTCTGAGGCCATCCGAGTTCCACCCACCTTGGAGGT
T
ACTCAACAGCCCATGAGGGCAGAGAACCAGGCAAACGTCACCTGCCAGGTGAGCAATTTCTACCCCCGG
GGA
CTACAGCTGACCTGGTTGGAGAATGGAAATGTGTCCCGGACAGAAACAGCTTCGACCCTCATAGAGA
AC
AAGGATGGCACCTACAACTGGATGAGCTGGCTCCTGGTGAACACCTGTGCCCACAGGGACGATGTGGT
G
CTCACCTGTCAGGTGGAGCATGATGGGCAGCAAGCAGTCAGCAAAAGCTATGCCCTGGAGATCTCAGCG
CAC
CAGAAGGAGCACGGCTCAGATATCACCCATGAAGCAGCGCTGGCTCCTACTGCTCCACTCCTCGTAG
CT
CTCCTCCTGGGCCCCAAGCTGCTACTGGTGGTTGGTGTCTCTGCCATCTACATCTGCTGGAAACAGAA
G
GCCTGA


Translation (398 aa):
MPVPASWPHLPSPFLLMTLLLGRLTGVAGEDELQVIQPEKSVSVAAGESATLRCAMTSLIPVGPIMWFRG
A
GAGRELIYNQKEGHFPRVTTVSELTKRNNLDFSISISNITPADAGTYYCVKFRKGSPDDVEFKSGAGTE
L
SVR
AKPSAPVVSGPAVRATPEHTVSFTCESHGFSPRDITLKWFKNGNELSDFQTNVDPAGDSVSYSIHS
T
ARVVLTRGDVHSQVICEIAHITLQGDPLRGTANLSEAIR
VPPTLEVTQQPMRAENQANVTCQVSNFYPR
G
LQLTWLENGNVSRTETASTLIENKDGTYNWMSWLLVNTCAHRDDVVLTCQVEHDGQQAVSKSYALEISA
H
QKEHGSDITH
EAALAPTAPLLVALLLGPKLLLVVGVSAIYICWKQKA



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser