NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS1292.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
1292.1 Public Homo sapiens 1 FMO3 22 109 92 CCDS HistoryNCBI Gene:2328Re-query CCDS DB by CCDS ID:1292.1Re-query CCDS DB by GeneID:2328See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 1292.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000367755.8 ENSP00000356729.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000367755.8Link to Ensembl Protein Viewer:ENSP00000356729.4Re-query CCDS DB by Nucleotide ID:ENST00000367755Re-query CCDS DB by Protein ID:ENSP00000356729
Original member NCBI NM_001002294.2 NP_001002294.1 Updated not alive Link to Nucleotide Sequence:NM_001002294.2Link to Protein Sequence:NP_001002294.1Re-query CCDS DB by Nucleotide ID:NM_001002294Re-query CCDS DB by Protein ID:NP_001002294
Current member NCBI NM_001002294.3 NP_001002294.1 Accepted alive Link to Nucleotide Sequence:NM_001002294.3Link to Protein Sequence:NP_001002294.1Re-query CCDS DB by Nucleotide ID:NM_001002294Re-query CCDS DB by Protein ID:NP_001002294Link to BLAST:NP_001002294.1
Original member NCBI NM_006894.5 NP_008825.4 Updated not alive Link to Nucleotide Sequence:NM_006894.5Link to Protein Sequence:NP_008825.4Re-query CCDS DB by Nucleotide ID:NM_006894Re-query CCDS DB by Protein ID:NP_008825
Current member NCBI NM_006894.6 NP_008825.4 Accepted alive Link to Nucleotide Sequence:NM_006894.6Link to Protein Sequence:NP_008825.4Re-query CCDS DB by Nucleotide ID:NM_006894Re-query CCDS DB by Protein ID:NP_008825Link to BLAST:NP_008825.4

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001002294.1 532 P31513 532 100% 0 0
NP_008825.4 532 P31513 532 100% 0 0

Chromosomal Locations for CCDS 1292.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 1 (NC_000001.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 171092659 171092790 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 171103785 171103973 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 171107675 171107837 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 171108079 171108221 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 171110798 171110997 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 171114007 171114362 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 171116208 171116280 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 171117100 171117442 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1599 nt):
ATGGGGAAGAAAGTGGCCATCATTGGAGCTGGTGTGAGTGGCTTGGCCTCCATCAGGAGCTGTCTGGAAG
AG
GGGCTGGAGCCCACCTGCTTTGAGAAGAGCAATGACATTGGGGGCCTGTGGAAATTTTCAGACCATGC
A
GAGGAGGGCAGGGCTAGCATTTACAAATCAGTCTTTTCCAACTCTTCCAAAGAGATGATGTGTTTCCCA
GAC
TTCCCATTTCCCGATGACTTCCCCAACTTTATGCACAACAGCAAGATCCAGGAATATATCATTGCAT
TT
GCCAAAGAAAAGAACCTCCTGAAGTACATACAATTTAAGACATTTGTATCCAGTGTAAATAAACATCC
T
GATTTTGCAACTACTGGCCAGTGGGATGTTACCACTGAAAGGGATGGTAAAAAAGAATCGGCTGTCTTT
GAT
GCTGTAATGGTTTGTTCCGGACATCATGTGTATCCCAACCTACCAAAAGAGTCCTTTCCAGGACTAA
AC
CACTTTAAAGGCAAATGCTTCCACAGCAGGGACTATAAAGAACCAGGTGTATTCAATGGAAAGCGTGT
C
CTGGTGGTTGGCCTGGGGAATTCGGGCTGTGATATTGCCACAGAACTCAGCCGCACAGCAGAACAGGTC
ATG
ATCAGTTCCAGAAGTGGCTCCTGGGTGATGAGCCGGGTCTGGGACAATGGTTATCCTTGGGACATGC
TG
CTCGTCACTCGATTTGGAACCTTCCTCAAGAACAATTTACCGACAGCCATCTCTGACTGGTTGTACGT
G
AAGCAGATGAATGCAAGATTCAAGCATGAAAACTATGGCTTGATGCCTTTAAATGGAGTCCTGAGGAAA
GAG
CCTGTATTTAACGATGAGCTCCCAGCAAGCATTCTGTGTGGCATTGTGTCCGTAAAGCCTAACGTGA
AG
GAATTCACAGAGACCTCGGCCATTTTTGAGGATGGGACCATATTTGAGGGCATTGACTGTGTAATCTT
T
GCAACAGGGTATAGTTTTGCCTACCCCTTCCTTGATGAGTCTATCATCAAAAGCAGAAACAATGAGATC
ATT
TTATTTAAAGGAGTATTTCCTCCTCTACTTGAGAAGTCAACCATAGCAGTGATTGGCTTTGTCCAGT
CC
CTTGGGGCTGCCATTCCCACAGTTGACCTCCAGTCCCGCTGGGCAGCACAAGTAATAAAGGGAACTTG
T
ACTTTGCCTTCTATGGAAGACATGATGAATGATATTAATGAGAAAATGGAGAAAAAGCGCAAATGGTTT
GGC
AAAAGCGAGACCATACAGACAGATTACATTGTTTATATGGATGAACTCTCCTCCTTCATTGGGGCAA
AG
CCCAACATCCCATGGCTGTTTCTCACAGATCCCAAATTGGCCATGGAAGTTTATTTTGGCCCTTGTAG
T
CCCTACCAGTTTAGGCTGGTGGGCCCAGGGCAGTGGCCAGGAGCCAGAAATGCCATACTGACCCAGTGG
GAC
CGGTCGTTGAAACCCATGCAGACACGAGTGGTCGGGAGACTTCAGAAGCCTTGCTTCTTTTTCCATT
GG
CTGAAGCTCTTTGCAATTCCTATTCTGTTAATCGCTGTTTTCCTTGTGTTGACCTAA


Translation (532 aa):
MGKKVAIIGAGVSGLASIRSCLEEGLEPTCFEKSNDIGGLWKFSDHAEEGRASIYKSVFSNSSKEMMCFP
D
FPFPDDFPNFMHNSKIQEYIIAFAKEKNLLKYIQFK
TFVSSVNKHPDFATTGQWDVTTERDGKKESAVF
D
AVMVCSGHHVYPNLPKESFP
GLNHFKGKCFHSRDYKEPGVFNGKRVLVVGLGNSGCDIATELSRTAEQV
M
ISSRSGSWVMSRVWDNGYPWDMLLVTRFGTFLKNNLPTAISDWLYVKQMNARFKHENYGLMPLN
GVLRK
E
PVFNDELPASILCGIVSVKPNVKEFTETSAIFEDGTIFEGIDCVIFATGYSFAYPFLDESIIKSRNNEI
I
LFKGVFPPLLEKSTIAVIGFVQSLGAAIPTVDLQSRWAAQVIK
GTCTLPSMEDMMNDINEKMEKKRKWF
G
KSETIQTDYIVYMDELSSFIGAKPNIPWLFLTDPKLAMEVYFGPCSPYQFRLVGPGQWPGARNAILTQW
D
RSLKPMQTRVVGRLQKPCFFFHWLKLFAIPILLIAVFLVLT




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser