NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Tuesday, July 23, 2024, starting at 8:00 a.m. EDT for up to 60 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS1289.2 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
1289.2 Public Homo sapiens 1 GORAB 24 110 108 CCDS HistoryNCBI Gene:92344Re-query CCDS DB by CCDS ID:1289.2Re-query CCDS DB by GeneID:92344See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)

Sequence IDs included in CCDS 1289.2

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000367763.8 ENSP00000356737.4 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000367763.8Link to Ensembl Protein Viewer:ENSP00000356737.4Re-query CCDS DB by Nucleotide ID:ENST00000367763Re-query CCDS DB by Protein ID:ENSP00000356737
Original member Current member NCBI NM_152281.3 NP_689494.3 MANE Select Accepted alive Link to Nucleotide Sequence:NM_152281.3Link to Protein Sequence:NP_689494.3Re-query CCDS DB by Nucleotide ID:NM_152281Re-query CCDS DB by Protein ID:NP_689494Link to BLAST:NP_689494.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_689494.3 369 Q5T7V8-1 369 100% 0 0

Chromosomal Locations for CCDS 1289.2

Assembly GRCh38.p14 (GCF_000001405.40)

On '+' strand of Chromosome 1 (NC_000001.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 170532224 170532284 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 170539210 170539567 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 170542491 170542592 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 170544705 170544845 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 170552015 170552462 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1110 nt):
ATGGCGCAAGGTTGGGCAGGATTCTCTGAGGAGGAACTGAGGAGACTAAAGCAGACTAAAGATCCATTTG
AA
CCACAGCGACGTCTCCCCGCGAAGAAAAGTCGACAACAACTTCAGCGAGAAAAAGCCCTTGTAGAGCA
A
AGCCAAAAACTTGGGCTTCAAGATGGATCAACCTCATTACTTCCAGAGCAGCTGCTTTCAGCACCAAAA
CAG
AGAGTTAACGTTCAAAAACCACCTTTTTCTTCCCCTACTCTTCCGAGTCATTTCACTCTCACCTCCC
CC
GTTGGTGATGGACAACCACAGGGCATTGAAAGTCAGCCAAAGGAACTGGGACTTGAGAATTCCCATGA
T
GGTCACAACAATGTTGAGATTCTACCTCCAAAGCCAGATTGCAAATTGGAGAAAAAGAAAGTGGAATTG
CAA
GAAAAATCTCGTTGGGAAGTCCTCCAACAAGAACAACGGCTAATGGAAGAGAAAAATAAACGTAAAA
AA
GCTCTTTTGGCTAAAGCTATTGCAGAAAGATCCAAAAGAACTCAGGCAGAGACCATGAAACTAAAGCG
G
ATCCAGAAGGAGTTGCAGGCTTTAGATGACATGGTGTCAGCTGACATTGGAATTCTCAGGAACCGGATT
GAT
CAGGCCAGCTTAGACTATTCATACGCTCGGAAGCGGTTTGACAGGGCTGAAGCAGAGTACATTGCAG
CA
AAGCTAGATATACAGCGCAAGACTGAGATAAAAGAGCAACTCACTGAACACCTTTGTACGATCATACA
G
CAAAATGAGCTCCGAAAGGCCAAGAAGTTGGAGGAGTTGATGCAACAACTAGATGTAGAAGCCGATGAA
GAG
ACTTTGGAGCTTGAGGTGGAGGTCGAGAGATTGCTACACGAACAAGAAGTAGAATCAAGGAGACCAG
TG
GTTCGTTTAGAGAGGCCATTTCAGCCTGCGGAGGAGAGTGTGACATTAGAATTTGCTAAAGAGAACAG
A
AAGTGTCAAGAACAAGCTGTTTCCCCAAAGGTAGATGACCAGTGTGGAAATTCCAGTAGCATCCCCTTT
CTT
AGTCCAAACTGCCCAAATCAAGAAGGTAATGACATTTCAGCTGCTTTGGCCACATGA


Translation (369 aa):
MAQGWAGFSEEELRRLKQTKDPFEPQRRLPAKKSRQQLQREKALVEQSQKLGLQDGSTSLLPEQLLSAPK
Q
RVNVQKPPFSSPTLPSHFTLTSPVGDGQPQGIESQPKELGLENSHDGHNNVEILPPKPDCKLEKKKVE
L
Q
EKSRWEVLQQEQRLMEEKNKRKKALLAKAIAE
RSKRTQAETMKLKRIQKELQALDDMVSADIGILRNRI
D
QASLDYSYA
RKRFDRAEAEYIAAKLDIQRKTEIKEQLTEHLCTIIQQNELRKAKKLEELMQQLDVEADE
E
TLELEVEVERLLHEQEVESRRPVVRLERPFQPAEESVTLEFAKENRKCQEQAVSPKVDDQCGNSSSIPF
L
SPNCPNQEGNDISAALAT




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser