NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS12775.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
12775.1 Public Homo sapiens 19 IRF3 22 109 92 CCDS HistoryNCBI Gene:3661Re-query CCDS DB by CCDS ID:12775.1Re-query CCDS DB by GeneID:3661See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 12775.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000309877.11 ENSP00000310127.6 Accepted alive Link to Ensembl Transcript Viewer:ENST00000309877.11Link to Ensembl Protein Viewer:ENSP00000310127.6Re-query CCDS DB by Nucleotide ID:ENST00000309877Re-query CCDS DB by Protein ID:ENSP00000310127
Original member Current member EBI ENST00000377139.7 ENSP00000366344.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000377139.7Link to Ensembl Protein Viewer:ENSP00000366344.3Re-query CCDS DB by Nucleotide ID:ENST00000377139Re-query CCDS DB by Protein ID:ENSP00000366344
Original member Current member EBI ENST00000597198.5 ENSP00000469113.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000597198.5Link to Ensembl Protein Viewer:ENSP00000469113.1Re-query CCDS DB by Nucleotide ID:ENST00000597198Re-query CCDS DB by Protein ID:ENSP00000469113
Original member NCBI NM_001571.5 NP_001562.1 Updated not alive Link to Nucleotide Sequence:NM_001571.5Link to Protein Sequence:NP_001562.1Re-query CCDS DB by Nucleotide ID:NM_001571Re-query CCDS DB by Protein ID:NP_001562
Current member NCBI NM_001571.6 NP_001562.1 Accepted alive Link to Nucleotide Sequence:NM_001571.6Link to Protein Sequence:NP_001562.1Re-query CCDS DB by Nucleotide ID:NM_001571Re-query CCDS DB by Protein ID:NP_001562Link to BLAST:NP_001562.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001562.1 427 Q14653-1 427 100% 0 0

Chromosomal Locations for CCDS 12775.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 19 (NC_000019.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 49659648 49659833 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 49660713 49660828 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 49661948 49662328 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 49662425 49662617 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 49663188 49663258 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 49663343 49663514 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 49664674 49664838 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1284 nt):
ATGGGAACCCCAAAGCCACGGATCCTGCCCTGGCTGGTGTCGCAGCTGGACCTGGGGCAACTGGAGGGCG
TG
GCCTGGGTGAACAAGAGCCGCACGCGCTTCCGCATCCCTTGGAAGCACGGCCTACGGCAGGATGCACA
G
CAGGAGGATTTCGGAATCTTCCAGGCCTGGGCCGAGGCCACTGGTGCATATGTTCCCGGGAGGGATAAG
CCA
GACCTGCCAACCTGGAAGAGGAATTTCCGCTCTGCCCTCAACCGCAAAGAAGGGTTGCGTTTAGCAG
AG
GACCGGAGCAAGGACCCTCACGACCCACATAAAATCTACGAGTTTGTGAACTCAGGAGTTGGGGACTT
T
TCCCAGCCAGACACCTCTCCGGACACCAATGGTGGAGGCAGTACTTCTGATACCCAGGAAGACATTCTG
GAT
GAGTTACTGGGTAACATGGTGTTGGCCCCACTCCCAGATCCGGGACCCCCAAGCCTGGCTGTAGCCC
CT
GAGCCCTGCCCTCAGCCCCTGCGGAGCCCCAGCTTGGACAATCCCACTCCCTTCCCAAACCTGGGGCC
C
TCTGAGAACCCACTGAAGCGGCTGTTGGTGCCGGGGGAAGAGTGGGAGTTCGAGGTGACAGCCTTCTAC
CGG
GGCCGCCAAGTCTTCCAGCAGACCATCTCCTGCCCGGAGGGCCTGCGGCTGGTGGGGTCCGAAGTGG
GA
GACAGGACGCTGCCTGGATGGCCAGTCACACTGCCAGACCCTGGCATGTCCCTGACAGACAGGGGAGT
G
ATGAGCTACGTGAGGCATGTGCTGAGCTGCCTGGGTGGGGGACTGGCTCTCTGGCGGGCCGGGCAGTGG
CTC
TGGGCCCAGCGGCTGGGGCACTGCCACACATACTGGGCAGTGAGCGAGGAGCTGCTCCCCAACAGCG
GG
CATGGGCCTGATGGCGAGGTCCCCAAGGACAAGGAAGGAGGCGTGTTTGACCTGGGGCCCTTCATTGT
A
GATCTGATTACCTTCACGGAAGGAAGCGGACGCTCACCACGCTATGCCCTCTGGTTCTGTGTGGGGGAG
TCA
TGGCCCCAGGACCAGCCGTGGACCAAGAGGCTCGTGATGGTCAAGGTTGTGCCCACGTGCCTCAGGG
CC
TTGGTAGAAATGGCCCGGGTAGGGGGTGCCTCCTCCCTGGAGAATACTGTGGACCTGCACATTTCCAA
C
AGCCACCCACTCTCCCTCACCTCCGACCAGTACAAGGCCTACCTGCAGGACTTGGTGGAGGGCATGGAT
TTC
CAGGGCCCTGGGGAGAGCTGA


Translation (427 aa):
MGTPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEATGAYVPGRDK
P
DLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNS
GVGDFSQPDTSPDTNGGGSTSDTQEDIL
D
ELLGNMVLAPLPDPGPPSLAVAPEPCPQPLRSPSLDNPTPFPNLGPSENPLKRLLVPGE
EWEFEVTAFY
R
GRQVFQQTISCPEGLRLVGSEVGDRTLPGWPVTLPDPGMSLTDRGVMSYVRHVLSCLGGGLALWRAGQW
L
WAQRLGHCHTYWAVSEELLPNSGHGPDGEVPKDKEGGVFDLGPFIV
DLITFTEGSGRSPRYALWFCVGE
S
WPQDQPWTKRLVMVK
VVPTCLRALVEMARVGGASSLENTVDLHISNSHPLSLTSDQYKAYLQDLVEGMD
F
QGPGES




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser