NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS12643.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
12643.1 Public Homo sapiens 19 CBLC 22 109 92 CCDS HistoryNCBI Gene:23624Re-query CCDS DB by CCDS ID:12643.1Re-query CCDS DB by GeneID:23624See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 12643.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000270279.7 ENSP00000270279.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000270279.7Link to Ensembl Protein Viewer:ENSP00000270279.3Re-query CCDS DB by Nucleotide ID:ENST00000270279Re-query CCDS DB by Protein ID:ENSP00000270279
Original member Current member EBI,WTSI ENST00000647358.1 ENSP00000494162.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000647358.1Link to Ensembl Protein Viewer:ENSP00000494162.1Re-query CCDS DB by Nucleotide ID:ENST00000647358Re-query CCDS DB by Protein ID:ENSP00000494162
Original member NCBI NM_012116.3 NP_036248.3 Updated not alive Link to Nucleotide Sequence:NM_012116.3Link to Protein Sequence:NP_036248.3Re-query CCDS DB by Nucleotide ID:NM_012116Re-query CCDS DB by Protein ID:NP_036248
Current member NCBI NM_012116.4 NP_036248.3 Accepted alive Link to Nucleotide Sequence:NM_012116.4Link to Protein Sequence:NP_036248.3Re-query CCDS DB by Nucleotide ID:NM_012116Re-query CCDS DB by Protein ID:NP_036248Link to BLAST:NP_036248.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_036248.3 474 Q9ULV8-1 474 100% 0 0

Chromosomal Locations for CCDS 12643.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 19 (NC_000019.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 44777932 44778284 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 44780905 44781051 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 44781207 44781363 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 44782370 44782491 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 44784264 44784401 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 44790004 44790091 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 44792383 44792514 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 44793474 44793620 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 44794204 44794281 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 44800381 44800443 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1425 nt):
ATGGCTCTGGCGGTGGCCCCGTGGGGGCGACAGTGGGAAGAGGCCCGCGCCCTGGGCCGGGCAGTCAGGA
TG
CTGCAGCGCCTAGAAGAGCAATGCGTCGACCCCCGGCTGTCCGTGAGTCCCCCTTCGCTGCGGGACCT
G
CTGCCCCGCACAGCGCAGCTGCTTCGAGAGGTGGCCCATTCTCGGCGGGCGGCCGGCGGAGGCGGCCCC
GGG
GGTCCCGGCGGCTCTGGGGACTTTCTACTCATCTACCTGGCCAATCTGGAGGCCAAGAGCAGGCAGG
TG
GCCGCGCTGCTGCCTCCCCGGGGCCGAAGGAGTGCCAACGACGAGCTCTTCCGGGCGGGCTCCAGACT
C
AGGCGACAGCTGGCCAAGCTGGCCATCATCTTCAGCCACATGCACGCAGAGCTGCACGCACTCTTCCCC
GGG
GGAAAGTACTGTGGACACATGTACCAGCTCACCAAGGCCCCCGCCCACACCTTCTGGAGGGAAAGTT
GC
GGAGCCCGGTGTGTGCTGCCCTGGGCTGAGTTTGAGTCCCTCCTGGGCACCTGCCACCCTGTGGAACC
A
GGCTGCACAGCCCTGGCCTTGCGCACCACCATTGACCTCACCTGCAGCGGGCACGTGTCCATCTTCGAG
TTC
GACGTCTTCACCAGGCTCTTTCAGCCATGGCCAACACTCCTCAAGAACTGGCAGCTCCTGGCAGTCA
AC
CACCCAGGCTACATGGCCTTCCTCACCTATGATGAGGTCCAAGAGCGTCTGCAGGCCTGCAGGGACAA
G
CCAGGCAGTTACATCTTCCGGCCCAGCTGTACTCGCCTGGGGCAGTGGGCCATCGGCTATGTGAGCTCA
GAT
GGCAGCATCCTGCAGACCATCCCTGCCAACAAACCCCTGTCCCAGGTGCTCCTGGAGGGACAGAAGG
AC
GGCTTCTACCTCTACCCAGATGGAAAGACCCACAACCCAGACCTGACTGAGCTCGGCCAGGCAGAACC
C
CAGCAGCGCATCCACGTGTCAGAGGAGCAGCTGCAGCTCTACTGGGCCATGGACTCCACATTTGAGCTC
TGC
AAGATCTGTGCTGAGAGCAACAAGGATGTGAAGATTGAGCCGTGCGGGCACCTGCTCTGCAGCTGCT
GC
CTGGCTGCCTGGCAGCACTCGGACAGCCAGACCTGCCCCTTCTGCCGCTGCGAGATCAAGGGCTGGGA
G
GCCGTGAGTATCTACCAGTTCCACGGTCAGGCTACTGCTGAGGACTCAGGGAACAGCAGTGACCAGGAA
GGC
AGGGAGTTGGAGCTGGGGCAGGTGCCCCTTTCGGCTCCTCCATTGCCCCCACGGCCAGATCTGCCCC
CC
AGGAAGCCCAGAAATGCCCAGCCGAAAGTGAGACTCCTAAAGGGGAACTCCCCTCCAGCTGCGCTGGG
A
CCCCAGGACCCTGCCCCGGCCTGA


Translation (474 aa):
MALAVAPWGRQWEEARALGRAVRMLQRLEEQCVDPRLSVSPPSLRDLLPRTAQLLREVAHSRRAAGGGGP
G
GPGGSGDFLLIYLANLEAKSRQVAALLPPRGRRSANDELFRAGSRL
RRQLAKLAIIFSHMHAELHALFP
G
GKYCGHMYQLTKAPAHTFWRESCGA
RCVLPWAEFESLLGTCHPVEPGCTALALRTTIDLTCSGHVSIFE
F
DVFTRLFQ
PWPTLLKNWQLLAVNHPGYMAFLTYDEVQERLQACRDKPGSYIFRPSCTRLGQWAIGYVSS
D
GSILQTIPANKPLSQVLLEGQKDG
FYLYPDGKTHNPDLTELGQAEPQQRIHVSEEQLQLYWAMDSTFEL
C
KICAESNKDVKIEPCGHLLCSCCLAAWQ
HSDSQTCPFCRCEIKGWEAVSIYQFHGQATAEDSGNSSDQE
G
RELELGQ
VPLSAPPLPPRPDLPPRKPRNAQPKVRLLKGNSPPAALGPQDPAPA



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser