NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS1250.2 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
1250.2 Public Homo sapiens 1 ALDH9A1 22 109 92 CCDS HistoryNCBI Gene:223Re-query CCDS DB by CCDS ID:1250.2Re-query CCDS DB by GeneID:223See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)

Sequence IDs included in CCDS 1250.2

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000354775.4 ENSP00000346827.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000354775.4Link to Ensembl Protein Viewer:ENSP00000346827.4Re-query CCDS DB by Nucleotide ID:ENST00000354775Re-query CCDS DB by Protein ID:ENSP00000346827
Original member NCBI NM_000696.3 NP_000687.3 Updated not alive Link to Nucleotide Sequence:NM_000696.3Link to Protein Sequence:NP_000687.3Re-query CCDS DB by Nucleotide ID:NM_000696Re-query CCDS DB by Protein ID:NP_000687
Current member NCBI NM_000696.4 NP_000687.3 Accepted alive Link to Nucleotide Sequence:NM_000696.4Link to Protein Sequence:NP_000687.3Re-query CCDS DB by Nucleotide ID:NM_000696Re-query CCDS DB by Protein ID:NP_000687Link to BLAST:NP_000687.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_000687.3 518 P49189-3 518 100% 0 0

Chromosomal Locations for CCDS 1250.2

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 1 (NC_000001.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 165663050 165663144 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 165665018 165665130 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 165667309 165667450 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 165668926 165669013 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 165669262 165669450 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 165679442 165679582 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 165680487 165680683 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 165682107 165682241 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 165682981 165683110 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 165695252 165695397 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 165698378 165698558 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1557 nt):
ATGTTTCTCCGAGCAGGCCTGGCCGCGCTCTCCCCGCTTCTTCGCAGTCTTCGGCCCTCTCCTGTCGCCG
CC
ATGAGCACTGGCACCTTCGTCGTGTCGCAGCCGCTCAATTACCGCGGCGGGGCCCGCGTGGAGCCGGC
G
GACGCCTCCGGTACCGAGAAAGCTTTCGAGCCAGCAACCGGCCGAGTGATAGCTACTTTCACATGTTCA
GGA
GAAAAGGAAGTAAATTTGGCTGTTCAAAATGCAAAGGCTGCTTTTAAAATATGGAGTCAAAAATCTG
GC
ATGGAGCGTTGCCGAATCCTTTTGGAGGCTGCCAGGATAATAAGGGAACGGGAGGATGAAATTGCTAC
T
ATGGAGTGCATCAACAATGGCAAGTCCATCTTTGAGGCCCGCTTGGACATTGACATTTCCTGGCAGTGC
CTG
GAGTATTATGCGGGCTTGGCTGCATCCATGGCTGGTGAACACATCCAGCTCCCAGGTGGATCGTTTG
GT
TATACCAGAAGAGAACCACTTGGGGTATGTGTGGGAATAGGAGCATGGAACTACCCCTTTCAGATTGC
C
TCTTGGAAGTCGGCTCCAGCATTAGCCTGTGGTAATGCCATGGTCTTTAAACCTTCTCCCTTTACACCT
GTT
TCTGCATTGCTACTGGCTGAAATCTACAGTGAGGCTGGTGTACCTCCTGGGCTCTTCAATGTGGTGC
AG
GGAGGGGCTGCCACAGGCCAGTTTCTGTGTCAGCATCCCGATGTGGCCAAAGTCTCCTTCACTGGAAG
T
GTGCCCACTGGCATGAAGATCATGGAGATGTCAGCTAAAGGAATCAAACCTGTTACCTTGGAACTTGGA
GGC
AAATCTCCACTCATCATCTTCTCAGACTGTGATATGAACAATGCTGTAAAGGGGGCGCTGATGGCCA
AC
TTCCTCACACAAGGCCAGGTTTGCTGTAATGGCACAAGAGTATTTGTGCAGAAAGAAATTCTTGATAA
A
TTTACAGAGGAAGTGGTGAAACAGACCCAAAGGATTAAAATTGGAGATCCCCTTCTGGAAGATACAAGG
ATG
GGTCCACTCATCAACCGACCACACCTGGAGCGAGTCCTTGGGTTTGTCAAAGTGGCAAAGGAGCAGG
GT
GCTAAAGTGTTATGTGGTGGAGATATATATGTACCTGAAGATCCCAAATTAAAGGATGGATATTACAT
G
AGACCTTGTGTATTAACTAATTGCAGAGACGACATGACCTGTGTGAAGGAAGAGATCTTTGGGCCTGTT
ATG
TCCATTTTATCATTTGACACTGAAGCTGAGGTTCTAGAAAGAGCCAATGATACCACTTTTGGACTAG
CA
GCTGGCGTCTTTACCAGGGACATCCAACGGGCTCATAGAGTGGTAGCTGAGCTTCAGGCTGGGACGTG
C
TTCATTAACAACTATAACGTCAGCCCAGTGGAGTTGCCCTTTGGTGGATATAAGAAGTCAGGATTTGGC
AGA
GAGAACGGCCGTGTGACAATCGAATATTATTCACAGCTGAAGACTGTGTGTGTGGAGATGGGTGATG
TG
GAATCTGCTTTTTGA


Translation (518 aa):
MFLRAGLAALSPLLRSLRPSPVAAMSTGTFVVSQPLNYRGGARVEPADASGTEKAFEPATGRVIATFTCS
G
EKEVNLAVQNAKAAFKIWSQKSGMERCRILLEAARIIR
EREDEIATMECINNGKSIFEARLDIDISWQC
L
EYYAGLAASMA
GEHIQLPGGSFGYTRREPLGVCVGIGAWNYPFQIASWKSAPALACGNAMVFKPSPFTP
V
SALLLAEIYSEAGVPPGLFNVVQGGAATGQFLCQHPDVAKVSFTGSVPTGMK
IMEMSAKGIKPVTLELG
G
KSPLIIFSDCDMNNAVKGALMANFLTQGQ
VCCNGTRVFVQKEILDKFTEEVVKQTQRIKIGDPLLEDTR
M
GPLINRPHLERVLGFVKVAKEQ
GAKVLCGGDIYVPEDPKLKDGYYMRPCVLTNCRDDMTCVKEEIFGPV
M
SILSFDTEAEVLERANDTTFGLAAGVFT
RDIQRAHRVVAELQAGTCFINNYNVSPVELPFGGYKKSGFG
R
ENGRVTIEYYSQLKTVCVEMGDVESAF




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser