NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS12478.2 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
12478.2 Public Homo sapiens 19 PRODH2 24 110 108 CCDS HistoryNCBI Gene:58510Re-query CCDS DB by CCDS ID:12478.2Re-query CCDS DB by GeneID:58510See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)

Sequence IDs included in CCDS 12478.2

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000301175.7 ENSP00000301175.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000301175.7Link to Ensembl Protein Viewer:ENSP00000301175.4Re-query CCDS DB by Nucleotide ID:ENST00000301175Re-query CCDS DB by Protein ID:ENSP00000301175
Original member Current member EBI ENST00000653904.2 ENSP00000499779.1 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000653904.2Link to Ensembl Protein Viewer:ENSP00000499779.1Re-query CCDS DB by Nucleotide ID:ENST00000653904Re-query CCDS DB by Protein ID:ENSP00000499779
Original member Current member NCBI NM_021232.2 NP_067055.2 MANE Select Accepted alive Link to Nucleotide Sequence:NM_021232.2Link to Protein Sequence:NP_067055.2Re-query CCDS DB by Nucleotide ID:NM_021232Re-query CCDS DB by Protein ID:NP_067055Link to BLAST:NP_067055.2

Chromosomal Locations for CCDS 12478.2

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 19 (NC_000019.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 35800038 35800222 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 35802191 35802276 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 35802968 35803078 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 35806430 35806596 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 35806675 35806830 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 35807041 35807121 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 35811962 35812048 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 35812134 35812272 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 35812360 35812556 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 35812632 35812805 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1383 nt):
ATGCTCCGGACCTGTTACGTGCTCTGTTCCCAAGCTGGTCCCCCCTCCAGGGGCTGGCAGTCCCTGAGCT
TT
GATGGCGGGGCCTTCCACCTTAAGGGCACAGGAGAGCTGACACGGGCCTTGCTGGTTCTCCGGCTGTG
T
GCCTGGCCCCCACTCGTCACTCACGGGCTGTTGCTCCAGGCCTGGTCTCGGCGACTCCTGGGCTCCCGG
CTC
TCAGGCGCATTTCTCCGAGCATCCGTCTATGGGCAGTTTGTGGCTGGTGAGACAGCAGAGGAGGTGA
AG
GGCTGCGTGCAGCAGCTGCGGACCCTCAGCCTCCGACCACTGCTGGCAGTGCCCACTGAGGAGGAGCC
G
GACTCTGCTGCCAAGAGTGGTGAGGCGTGGTATGAGGGGAACCTCGGTGCTATGCTGCGGTGTGTGGAC
CTG
TCACGGGGCCTCCTGGAGCCCCCCAGCCTGGCTGAGGCCAGCCTCATGCAGCTGAAGGTGACGGCGC
TG
ACCAGTACTCGGCTCTGTAAGGAGCTAGCCTCGTGGGTCAGAAGGCCAGGAGCCTCCTTGGAGCTGAG
C
CCCGAGAGGCTGGCTGAAGCTATGGACTCTGGGCAGAACCTCCAGGTCTCCTGCCTCAATGCTGAGCAG
AAC
CAGCACCTCCGGGCCTCCCTCAGCCGCCTGCATCGGGTGGCACAGTATGCCCGGGCCCAGCACGTGC
GG
CTCCTGGTGGATGCGGAGTACACCTCACTGAACCCTGCGCTCTCGCTGCTGGTGGCTGCCCTGGCTGT
G
CGCTGGAACAGCCCGGGTGAAGGCGGGCCCTGGGTGTGGAACACCTACCAGGCCTGTCTAAAGGACACA
TTC
GAGCGGCTGGGGAGGGATGCAGAGGCTGCGCACAGGGCCGGCCTGGCCTTCGGAGTGAAGCTGGTAC
GA
GGTGCATATCTGGACAAGGAGAGAGCGGTGGCCCAGCTCCATGGGATGGAAGACCCCACTCAGCCTGA
C
TATGAGGCCACCAGTCAGAGTTACAGCCGCTGCCTGGAACTGATGCTGACGCACGTGGCCCGCCATGGC
CCC
ATGTGCCACCTCATGGTGGCTTCCCACAATGAGGAATCTGTTCGCCAGGCAACCAAGCGCATGTGGG
AG
CTGGGCATTCCTCTGGATGGGACTGTCTGTTTCGGACAACTTCTGGGCATGTGTGACCACGTCTCTCT
A
GCACTGGGGCAGGCCGGCTATGTAGTGTATAAGTCCATTCCCTATGGCTCCTTGGAGGAGGTAATCCCC
TAC
CTGATCCGGAGGGCCCAGGAGAACCGGAGCGTGCTTCAGGGTGCCCGCAGGGAACAGGAGCTGCTCA
GC
CAAGAACTGTGGCGGCGGCTGCTGCCAGGATGCCGAAGGATACCCCACTAG


Translation (460 aa):
MLRTCYVLCSQAGPPSRGWQSLSFDGGAFHLKGTGELTRALLVLRLCAWPPLVTHGLLLQAWSRRLLGSR
L
SGAFLRASVYGQFVAGETAEEVKGCVQQLRTLSLRPLLAVPTEEEPDSAAKS
GEAWYEGNLGAMLRCVD
L
SRGLLEPPSLAEASLMQLKVTALTSTRLC
KELASWVRRPGASLELSPERLAEAMDSGQNLQVSCLNAEQ
N
QHLRASLSRLHRVAQ
YARAQHVRLLVDAEYTSLNPALSLLVAALAVRWNSPGEGGPWVWNTYQACLKDT
F
ERLGRDAEAAHRAGLAFGVKLVRGAYLDKERAVAQLHGMEDPTQPDYEATSQ
SYSRCLELMLTHVARHG
P
MCHLMVASHNEESVRQATK
RMWELGIPLDGTVCFGQLLGMCDHVSLALGQAGYVVYKSIPYGSLEEVIP
Y
LIRRAQENRSVLQGARREQELLSQELWRRLLPGCRRIPH




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser