NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Wednesday, September 28, 2022, starting at 8:00 a.m. EDT for up to 60 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS12332.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
12332.1 Public Homo sapiens 19 CYP4F3 22 109 92 CCDS HistoryNCBI Gene:4051Re-query CCDS DB by CCDS ID:12332.1Re-query CCDS DB by GeneID:4051See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 12332.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000221307.12 ENSP00000221307.6 Accepted alive Link to Ensembl Transcript Viewer:ENST00000221307.12Link to Ensembl Protein Viewer:ENSP00000221307.6Re-query CCDS DB by Nucleotide ID:ENST00000221307Re-query CCDS DB by Protein ID:ENSP00000221307
Original member NCBI NM_000896.2 NP_000887.2 Updated not alive Link to Nucleotide Sequence:NM_000896.2Link to Protein Sequence:NP_000887.2Re-query CCDS DB by Nucleotide ID:NM_000896Re-query CCDS DB by Protein ID:NP_000887
Current member NCBI NM_000896.3 NP_000887.2 Accepted alive Link to Nucleotide Sequence:NM_000896.3Link to Protein Sequence:NP_000887.2Re-query CCDS DB by Nucleotide ID:NM_000896Re-query CCDS DB by Protein ID:NP_000887Link to BLAST:NP_000887.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_000887.2 520 Q08477-1 520 100% 0 0

Chromosomal Locations for CCDS 12332.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 19 (NC_000019.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 15641416 15641613 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 15645719 15645863 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 15647052 15647105 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 15647197 15647324 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 15649160 15649281 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 15649913 15650183 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 15652569 15652635 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 15652823 15652952 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 15658264 15658397 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 15658491 15658555 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 15658727 15658809 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 15659220 15659385 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1563 nt):
ATGCCACAGCTGAGCCTGTCCTCGCTGGGCCTTTGGCCAATGGCAGCATCCCCGTGGCTGCTCCTGCTGC
TG
GTTGGGGCCTCCTGGCTCCTGGCCCGCATCCTGGCCTGGACCTATACCTTCTATGACAACTGCTGCCG
C
CTCCGGTGTTTCCCGCAACCCCCGAAACGGAATTGGTTCTTGGGTCACCTGGGCCTGATTCACAGCTCG
GAG
GAAGGTCTCCTATACACACAAAGCCTGGCATGCACCTTCGGTGATATGTGCTGCTGGTGGGTGGGGC
CC
TGGCACGCAATCGTCCGCATCTTCCACCCCACCTACATCAAGCCTGTGCTCTTTGCTCCAGCTGCCAT
T
GTACCAAAGGACAAGGTCTTCTACAGCTTCCTGAAGCCCTGGCTGGGGGATGGGCTCCTGCTGAGTGCT
GGT
GAAAAGTGGAGCCGCCACCGTCGGATGCTGACGCCTGCCTTCCATTTCAACATCCTGAAGCCCTATA
TG
AAGATTTTCAATGAGAGTGTGAACATCATGCATGCCAAGTGGCAGCTCCTGGCCTCAGAGGGTAGTGC
C
CGTCTGGACATGTTTGAGCACATCAGCCTCATGACCTTGGACAGTCTGCAGAAATGTGTCTTCAGCTTT
GAC
AGCCATTGCCAGGAGAAGCCCAGTGAATATATTGCCGCCATCTTGGAGCTCAGTGCCCTTGTGACAA
AA
AGACACCAGCAGATCCTCCTGTACATAGACTTCCTGTATTATCTCACCCCTGATGGGCAGCGTTTCCG
C
AGGGCCTGCCGCCTGGTGCACGACTTCACAGATGCCGTCATCCAGGAGCGGCGCCGCACCCTCCCTAGC
CAG
GGTGTTGATGACTTCCTCCAAGCCAAGGCCAAATCCAAGACTTTGGACTTCATTGATGTACTCCTGC
TG
AGCAAGGATGAAGATGGGAAGAAGTTGTCCGATGAGGACATAAGAGCAGAAGCTGACACCTTTATGTT
T
GAGGGCCATGACACCACAGCCAGTGGTCTCTCCTGGGTCCTGTACCACCTTGCAAAGCACCCGGAATAC
CAG
GAGCGCTGTCGGCAGGAGGTGCAAGAGCTTCTGAAGGACCGTGAGCCTAAAGAGATTGAATGGGACG
AC
CTGGCCCAGCTGCCCTTCCTGACCATGTGCATTAAGGAGAGCCTGAGGCTGCATCCCCCAGTCCCTGC
C
GTCTCTCGCTGCTGCACCCAAGACATTGTGCTCCCAGACGGCCGGGTCATCCCCAAAGGCATTATCTGC
CTC
ATCAGTGTTTTTGGAACCCATCACAACCCAGCCGTGTGGCCGGACCCTGAGGTCTATGACCCCTTTC
GC
TTTGACCCAAAGAACATCAAGGAGAGGTCACCTCTGGCTTTTATTCCCTTCTCAGCAGGGCCCAGGAA
C
TGCATCGGGCAGGCGTTCGCGATGGCGGAGATGAAGGTGGTCCTGGGGCTCACGCTGCTGCGCTTCCGC
GTC
CTGCCTGACCACACCGAGCCCCGCAGGAAGCCGGAGCTGGTCCTGCGCGCAGAGGGCGGACTTTGGC
TG
CGGGTGGAGCCCCTGAGCTGA


Translation (520 aa):
MPQLSLSSLGLWPMAASPWLLLLLVGASWLLARILAWTYTFYDNCCRLRCFPQPPKRNWFLGHLGLIHSS
E
EGLLYTQSLACTFGDMCCWWVGPWHAIVRIFHPTYIKPVLFAP
AAIVPKDKVFYSFLKPWLGDGLLLSA
G
EKWSRHRRMLTPAFHFNILKPYMKIFNESVNIMH
AKWQLLASEGSARLDMFEHISLMTLDSLQKCVFSF
D
SHCQ
EKPSEYIAAILELSALVTKRHQQILLYIDFLYYLTPDGQRFRRACRLVHDFTDAVIQERRRTLPS
Q
GVDDFLQAKAKSKTLDFIDVLLLSK
DEDGKKLSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEY
Q
ERCRQEVQELLKDREPKEIE
WDDLAQLPFLTMCIKESLRLHPPVPAVSRCCTQDIVLPDGRVIPKGIIC
L
ISVFGTHHNPAVWPDPE
VYDPFRFDPKNIKERSPLAFIPFSAGPRNCIGQAFAMAEMKVVLGLTLLRFR
V
LPDHTEPRRKPELVLRAEGGLWLRVEPLS




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser