NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS12161.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
12161.1 Public Homo sapiens 19 ACER1 22 109 92 CCDS HistoryNCBI Gene:125981Re-query CCDS DB by CCDS ID:12161.1Re-query CCDS DB by GeneID:125981See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 12161.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000301452.4 ENSP00000301452.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000301452.4Link to Ensembl Protein Viewer:ENSP00000301452.3Re-query CCDS DB by Nucleotide ID:ENST00000301452Re-query CCDS DB by Protein ID:ENSP00000301452
Original member Current member NCBI NM_133492.2 NP_597999.1 Accepted alive Link to Nucleotide Sequence:NM_133492.2Link to Protein Sequence:NP_597999.1Re-query CCDS DB by Nucleotide ID:NM_133492Re-query CCDS DB by Protein ID:NP_597999Link to BLAST:NP_597999.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_597999.1 264 Q8TDN7 264 100% 0 0

Chromosomal Locations for CCDS 12161.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 19 (NC_000019.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 6306714 6306882 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 6307153 6307290 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 6309697 6309834 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 6312149 6312290 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 6312385 6312499 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 6333459 6333551 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (795 nt):
ATGCCTAGCATCTTCGCCTATCAGAGCTCCGAGGTGGACTGGTGTGAGAGCAACTTCCAGTACTCGGAGC
TG
GTGGCCGAGTTCTACAACACGTTCTCCAATATCCCCTTCTTCATCTTCGGGCCACTGATGATGCTCCT
G
ATGCACCCGTATGCCCAGAAGCGCTCCCGCTACATTTACGTTGTCTGGGTCCTCTTCATGATCATAGGC
CTG
TTCTCCATGTATTTCCACATGACGCTCAGCTTCCTGGGCCAGCTGCTGGACGAGATCGCCATCCTGT
GG
CTCCTGGGCAGTGGCTATAGCATATGGATGCCCCGCTGCTATTTCCCCTCCTTCCTTGGGGGGAACAG
G
TCCCAGTTCATCCGCCTGGTCTTCATCACCACTGTGGTCAGCACCCTTCTGTCCTTCCTGCGGCCCACG
GTC
AACGCCTACGCCCTCAACAGCATTGCCCTGCACATTCTCTACATCGTGTGCCAGGAGTACAGGAAGA
CC
AGCAATAAGGAGCTTCGGCACCTGATTGAGGTCTCCGTGGTTTTATGGGCTGTTGCTCTGACCAGCTG
G
ATCAGTGACCGTCTGCTTTGCAGCTTCTGGCAGAGGATTCATTTCTTCTATCTGCACAGCATCTGGCAT
GTG
CTCATCAGCATCACCTTCCCTTATGGCATGGTCACCATGGCCTTGGTGGATGCCAACTATGAGATGC
CA
GGTGAAACCCTCAAAGTCCGCTACTGGCCTCGGGACAGTTGGCCCGTGGGGCTGCCCTACGTGGAAAT
C
CGGGGTGATGACAAGGACTGCTGA


Translation (264 aa):
MPSIFAYQSSEVDWCESNFQYSELVAEFYNTFSNIPFFIFGPLMMLLMHPYAQKRSRYIYVVWVLFMIIG
L
FSMYFHMTLSFLGQLLDEIAILWLLGSGYSIWMPRCYFPSFLGGN
RSQFIRLVFITTVVSTLLSFLRPT
V
NAYALNSIALHILYIVCQEYR
KTSNKELRHLIEVSVVLWAVALTSWISDRLLCSFWQRIHFFYLHSIWH
V
LISITFPYGMVTMALVDANYEMPGETLKVRYWPRDSWPVGLPYVEIRGDDKDC




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser