NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Thursday, April 25, 2024, starting at 7:00 a.m. EDT for up to 120 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS12103.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
12103.1 Public Homo sapiens 19 GNA11 24 110 108 CCDS HistoryNCBI Gene:2767Re-query CCDS DB by CCDS ID:12103.1Re-query CCDS DB by GeneID:2767See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 12103.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000078429.9 ENSP00000078429.3 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000078429.9Link to Ensembl Protein Viewer:ENSP00000078429.3Re-query CCDS DB by Nucleotide ID:ENST00000078429Re-query CCDS DB by Protein ID:ENSP00000078429
Original member Current member NCBI NM_002067.5 NP_002058.2 MANE Select Accepted alive Link to Nucleotide Sequence:NM_002067.5Link to Protein Sequence:NP_002058.2Re-query CCDS DB by Nucleotide ID:NM_002067Re-query CCDS DB by Protein ID:NP_002058Link to BLAST:NP_002058.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_002058.2 359 P29992 359 100% 0 0

Chromosomal Locations for CCDS 12103.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '+' strand of Chromosome 19 (NC_000019.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 3094652 3094787 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 3110149 3110333 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 3113330 3113484 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 3114944 3115072 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 3118924 3119053 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 3119206 3119359 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 3120989 3121179 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1080 nt):
ATGACTCTGGAGTCCATGATGGCGTGTTGCCTGAGCGATGAGGTGAAGGAGTCCAAGCGGATCAACGCCG
AG
ATCGAGAAGCAGCTGCGGCGGGACAAGCGCGACGCCCGGCGCGAGCTCAAGCTGCTGCTGCTCGGCAC
G
GGCGAGAGCGGGAAGAGCACGTTCATCAAGCAGATGCGCATCATCCACGGCGCCGGCTACTCGGAGGAG
GAC
AAGCGCGGCTTCACCAAGCTCGTCTACCAGAACATCTTCACCGCCATGCAGGCCATGATCCGGGCCA
TG
GAGACGCTCAAGATCCTCTACAAGTACGAGCAGAACAAGGCCAATGCGCTCCTGATCCGGGAGGTGGA
C
GTGGAGAAGGTGACCACCTTCGAGCATCAGTACGTCAGTGCCATCAAGACCCTGTGGGAGGACCCGGGC
ATC
CAGGAATGCTACGACCGCAGGCGCGAGTACCAGCTCTCCGACTCTGCCAAGTACTACCTGACCGACG
TT
GACCGCATCGCCACCTTGGGCTACCTGCCCACCCAGCAGGACGTGCTGCGGGTCCGCGTGCCCACCAC
C
GGCATCATCGAGTACCCTTTCGACCTGGAGAACATCATCTTCCGGATGGTGGATGTGGGGGGCCAGCGG
TCG
GAGCGGAGGAAGTGGATCCACTGCTTTGAGAACGTGACATCCATCATGTTTCTCGTCGCCCTCAGCG
AA
TACGACCAAGTCCTGGTGGAGTCGGACAACGAGAACCGGATGGAGGAGAGCAAAGCCCTGTTCCGGAC
C
ATCATCACCTACCCCTGGTTCCAGAACTCCTCCGTCATCCTCTTCCTCAACAAGAAGGACCTGCTGGAG
GAC
AAGATCCTGTACTCGCACCTGGTGGACTACTTCCCCGAGTTCGATGGTCCCCAGCGGGACGCCCAGG
CG
GCGCGGGAGTTCATCCTGAAGATGTTCGTGGACCTGAACCCCGACAGCGACAAGATCATCTACTCACA
C
TTCACGTGTGCCACCGACACGGAGAACATCCGCTTCGTGTTCGCGGCCGTGAAGGACACCATCCTGCAG
CTC
AACCTCAAGGAGTACAACCTGGTCTGA


Translation (359 aa):
MTLESMMACCLSDEVKESKRINAEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGAGYSEE
D
KRGFTKLVYQNIFTAMQAMIRAMETLKILYKYEQNK
ANALLIREVDVEKVTTFEHQYVSAIKTLWEDPG
I
QECYDRRREYQLSDSAK
YYLTDVDRIATLGYLPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQR
S
ERRKWIHCFENVTSIMFLVALSEYDQVLVESDNE
NRMEESKALFRTIITYPWFQNSSVILFLNKKDLLE
D
KILYSHLVDYFPEFD
GPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQ
L
NLKEYNLV




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser