NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Tuesday, November 18, 2025, starting at 8:00 a.m. EST for up to 60 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS12073.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
12073.1 Public Homo sapiens 19 UQCR11 24 110 108 CCDS HistoryNCBI Gene:10975Re-query CCDS DB by CCDS ID:12073.1Re-query CCDS DB by GeneID:10975See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 12073.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000585671.2 ENSP00000466420.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000585671.2Link to Ensembl Protein Viewer:ENSP00000466420.1Re-query CCDS DB by Nucleotide ID:ENST00000585671Re-query CCDS DB by Protein ID:ENSP00000466420
Original member Current member EBI ENST00000591899.8 ENSP00000467262.1 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000591899.8Link to Ensembl Protein Viewer:ENSP00000467262.1Re-query CCDS DB by Nucleotide ID:ENST00000591899Re-query CCDS DB by Protein ID:ENSP00000467262
Original member Current member EBI ENST00000589880.1 ENSP00000467555.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000589880.1Link to Ensembl Protein Viewer:ENSP00000467555.1Re-query CCDS DB by Nucleotide ID:ENST00000589880Re-query CCDS DB by Protein ID:ENSP00000467555
Original member Current member EBI ENST00000585937.1 ENSP00000468614.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000585937.1Link to Ensembl Protein Viewer:ENSP00000468614.1Re-query CCDS DB by Nucleotide ID:ENST00000585937Re-query CCDS DB by Protein ID:ENSP00000468614
Original member Current member NCBI NM_006830.4 NP_006821.1 MANE Select Accepted alive Link to Nucleotide Sequence:NM_006830.4Link to Protein Sequence:NP_006821.1Re-query CCDS DB by Nucleotide ID:NM_006830Re-query CCDS DB by Protein ID:NP_006821Link to BLAST:NP_006821.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_006821.1 56 O14957 56 100% 0 0

Chromosomal Locations for CCDS 12073.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 19 (NC_000019.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 1599440 1599560 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 1605360 1605409 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (171 nt):
ATGGTGACCCGGTTCCTGGGCCCACGCTACCGGGAGCTGGTCAAGAACTGGGTCCCGACGGCCTACACAT
GG
GGCGCTGTGGGCGCCGTGGGGCTGGTGTGGGCCACCGATTGGCGGCTGATCCTGGACTGGGTACCTTA
C
ATCAATGGCAAGTTTAAGAAGGATAATTAA


Translation (56 aa):
MVTRFLGPRYRELVKNWVPTAYTWGAVGAVGLVWATDWRLILDWVPYINGKFKKDN



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser