NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS12070.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
12070.1 Public Homo sapiens 19 REEP6 24 110 108 CCDS HistoryNCBI Gene:92840Re-query CCDS DB by CCDS ID:12070.1Re-query CCDS DB by GeneID:92840See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 12070.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000233596.8 ENSP00000233596.2 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000233596.8Link to Ensembl Protein Viewer:ENSP00000233596.2Re-query CCDS DB by Nucleotide ID:ENST00000233596Re-query CCDS DB by Protein ID:ENSP00000233596
Original member Current member NCBI NM_138393.4 NP_612402.1 MANE Select Accepted alive Link to Nucleotide Sequence:NM_138393.4Link to Protein Sequence:NP_612402.1Re-query CCDS DB by Nucleotide ID:NM_138393Re-query CCDS DB by Protein ID:NP_612402Link to BLAST:NP_612402.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_612402.1 184 Q96HR9-2 184 100% 0 0

Chromosomal Locations for CCDS 12070.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '+' strand of Chromosome 19 (NC_000019.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 1491270 1491384 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 1495294 1495387 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 1495469 1495607 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 1496285 1496453 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 1497174 1497211 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (555 nt):
ATGGACGGCCTGAGGCAGCGCGTGGAGCACTTCCTGGAGCAAAGGAACCTGGTCACCGAAGTGCTGGGGG
CG
CTGGAGGCCAAGACCGGGGTGGAGAAGCGGTATCTGGCTGCAGGAGCCGTCACTCTGCTAAGCCTGTA
T
CTGCTGTTCGGCTACGGAGCGTCTCTGCTGTGCAATCTCATCGGATTTGTGTACCCCGCATATGCCTCA
ATC
AAAGCTATCGAGAGCCCAAGCAAGGACGACGACACTGTGTGGCTCACCTACTGGGTGGTGTACGCCC
TG
TTTGGGCTGGCCGAGTTCTTCAGCGATCTACTCCTGTCCTGGTTCCCTTTCTACTACGTGGGCAAGTG
C
GCCTTCCTGTTGTTCTGCATGGCTCCCAGGCCCTGGAACGGGGCTCTCATGCTGTATCAGCGCGTCGTG
CGT
CCGCTGTTCCTAAGGCACCACGGGGCCGTAGACAGAATCATGAACGACCTCAGCGGGCGAGCCCTGG
AC
GCGGCGGCCGGAATAACCAGGAACGTCAAGCCAAGCCAGACCCCGCAGCCGAAGGACAAGTGA


Translation (184 aa):
MDGLRQRVEHFLEQRNLVTEVLGALEAKTGVEKRYLAAGAVTLLSLYLLFGYGASLLCNLIGFVYPAYAS
I
KAIESPSKDDDTVWLTYWVVYALFGLAEFFSDLLLSWFPFYYVGK
CAFLLFCMAPRPWNGALMLYQRVV
R
PLFLRHHGAVDRIMNDLSGRALDAAAGITRN
VKPSQTPQPKDK



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser