NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Tuesday, July 23, 2024, starting at 8:00 a.m. EDT for up to 60 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS11965.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
11965.1 Public Homo sapiens 18 ATP8B1 24 110 108 CCDS HistoryNCBI Gene:5205Re-query CCDS DB by CCDS ID:11965.1Re-query CCDS DB by GeneID:5205See the combined annotation on chromosome 18 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 11965.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000648908.2 ENSP00000497896.1 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000648908.2Link to Ensembl Protein Viewer:ENSP00000497896.1Re-query CCDS DB by Nucleotide ID:ENST00000648908Re-query CCDS DB by Protein ID:ENSP00000497896
Original member Current member NCBI NM_001374385.1 NP_001361314.1 MANE Select Accepted alive Link to Nucleotide Sequence:NM_001374385.1Link to Protein Sequence:NP_001361314.1Re-query CCDS DB by Nucleotide ID:NM_001374385Re-query CCDS DB by Protein ID:NP_001361314Link to BLAST:NP_001361314.1
Original member Current member NCBI NM_005603.6 NP_005594.2 Accepted alive Link to Nucleotide Sequence:NM_005603.6Link to Protein Sequence:NP_005594.2Re-query CCDS DB by Nucleotide ID:NM_005603Re-query CCDS DB by Protein ID:NP_005594Link to BLAST:NP_005594.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001361314.1 1251 O43520 1251 100% 0 0
NP_005594.2 1251 O43520 1251 100% 0 0

Chromosomal Locations for CCDS 11965.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 18 (NC_000018.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18See the combined annotation on chromosome 18 in Sequence Viewer

Chromosome Start Stop Links
18 57648488 57648712 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 57650367 57650497 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 57652034 57652172 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 57652484 57652729 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 57653992 57654075 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 57655194 57655417 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 57661174 57661462 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 57662483 57662615 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 57667092 57667167 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 57668429 57668540 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 57669318 57669482 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 57671468 57671580 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 57674834 57675022 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 57684036 57684192 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 57685072 57685115 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 57688299 57688507 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 57691807 57691997 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 57694582 57694670 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 57695171 57695329 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 57695450 57695532 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 57697618 57697688 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 57697795 57697867 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 57701039 57701100 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 57701215 57701313 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 57704555 57704668 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 57706490 57706587 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 57731627 57731807 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3756 nt):
ATGAGTACAGAAAGAGACTCAGAAACGACATTTGACGAGGATTCTCAGCCTAATGACGAAGTGGTTCCCT
AC
AGTGATGATGAAACAGAAGATGAACTTGATGACCAGGGGTCTGCTGTTGAACCAGAACAAAACCGAGT
C
AACAGGGAAGCAGAGGAGAACCGGGAGCCATTCAGAAAAGAATGTACATGGCAAGTCAAAGCAAACGAT
CGC
AAGTACCACGAACAACCTCACTTTATGAACACAAAATTCTTGTGTATTAAGGAGAGTAAATATGCGA
AT
AATGCAATTAAAACATACAAGTACAACGCATTTACCTTTATACCAATGAATCTGTTTGAGCAGTTTAA
G
AGAGCAGCCAATTTATATTTCCTGGCTCTTCTTATCTTACAGGCAGTTCCTCAAATCTCTACCCTGGCT
TGG
TACACCACACTAGTGCCCCTGCTTGTGGTGCTGGGCGTCACTGCAATCAAAGACCTGGTGGACGATG
TG
GCTCGCCATAAAATGGATAAGGAAATCAACAATAGGACGTGTGAAGTCATTAAGGATGGCAGGTTCAA
A
GTTGCTAAGTGGAAAGAAATTCAAGTTGGAGACGTCATTCGTCTGAAAAAAAATGATTTTGTTCCAGCT
GAC
ATTCTCCTGCTGTCTAGCTCTGAGCCTAACAGCCTCTGCTATGTGGAAACAGCAGAACTGGATGGAG
AA
ACCAATTTAAAATTTAAGATGTCACTTGAAATCACAGACCAGTACCTCCAAAGAGAAGATACATTGGC
T
ACATTTGATGGTTTTATTGAATGTGAAGAACCCAATAACAGACTAGATAAGTTTACAGGAACACTATTT
TGG
AGAAACACAAGTTTTCCTTTGGATGCTGATAAAATTTTGTTACGTGGCTGTGTAATTAGGAACACCG
AT
TTCTGCCACGGCTTAGTCATTTTTGCAGGTGCTGACACTAAAATAATGAAGAATAGTGGGAAAACCAG
A
TTTAAAAGAACTAAAATTGATTACTTGATGAACTACATGGTTTACACGATCTTTGTTGTTCTTATTCTG
CTT
TCTGCTGGTCTTGCCATCGGCCATGCTTATTGGGAAGCACAGGTGGGCAATTCCTCTTGGTACCTCT
AT
GATGGAGAAGACGATACACCCTCCTACCGTGGATTCCTCATTTTCTGGGGCTATATCATTGTTCTCAA
C
ACCATGGTACCCATCTCTCTCTATGTCAGCGTGGAAGTGATTCGTCTTGGACAGAGTCACTTCATCAAC
TGG
GACCTGCAAATGTACTATGCTGAGAAGGACACACCCGCAAAAGCTAGAACCACCACACTCAATGAAC
AG
CTCGGGCAGATCCATTATATCTTCTCTGATAAGACGGGGACACTCACACAAAATATCATGACCTTTAA
A
AAGTGCTGTATCAACGGGCAGATATATGGGGACCATCGGGATGCCTCTCAACACAACCACAACAAAATA
GAG
CAAGTTGATTTTAGCTGGAATACATATGCTGATGGGAAGCTTGCATTTTATGACCACTATCTTATTG
AG
CAAATCCAGTCAGGGAAAGAGCCAGAAGTACGACAGTTCTTCTTCTTGCTCGCAGTTTGCCACACAGT
C
ATGGTGGATAGGACTGATGGTCAGCTCAACTACCAGGCAGCCTCTCCCGATGAAGGTGCCCTGGTAAAC
GCT
GCCAGGAACTTTGGCTTTGCCTTCCTCGCCAGGACCCAGAACACCATCACCATCAGTGAACTGGGCA
CT
GAAAGGACTTACAATGTTCTTGCCATTTTGGACTTCAACAGTGACCGGAAGCGAATGTCTATCATTGT
A
AGAACCCCAGAAGGCAATATCAAGCTTTACTGTAAAGGTGCTGACACTGTTATTTATGAACGGTTACAT
CGA
ATGAATCCTACTAAGCAAGAAACACAGGATGCCCTGGATATCTTTGCAAATGAAACTCTTAGAACCC
TA
TGCCTTTGCTACAAGGAAATTGAAGAAAAAGAATTTACAGAATGGAATAAAAAGTTTATGGCTGCCAG
T
GTGGCCTCCACCAACCGGGACGAAGCTCTGGATAAAGTATATGAGGAGATTGAAAAAGACTTAATTCTC
CTG
GGAGCTACAGCTATTGAAGACAAGCTACAGGATGGAGTTCCAGAAACCATTTCAAAACTTGCAAAAG
CT
GACATTAAGATCTGGGTGCTTACTGGAGACAAAAAGGAAACTGCTGAAAATATAGGATTTGCTTGTGA
A
CTTCTGACTGAAGACACCACCATCTGCTATGGGGAGGATATTAATTCTCTTCTTCATGCAAGGATGGAA
AAC
CAGAGGAATAGAGGTGGCGTCTACGCAAAGTTTGCACCTCCTGTGCAGGAATCTTTTTTTCCACCCG
GT
GGAAACCGTGCCTTAATCATCACTGGTTCTTGGTTGAATGAAATTCTTCTCGAGAAAAAGACCAAGAG
A
AATAAGATTCTGAAGCTGAAGTTCCCAAGAACAGAAGAAGAAAGACGGATGCGGACCCAAAGTAAAAGG
AGG
CTAGAAGCTAAGAAAGAGCAGCGGCAGAAAAACTTTGTGGACCTGGCCTGCGAGTGCAGCGCAGTCA
TC
TGCTGCCGCGTCACCCCCAAGCAGAAGGCCATGGTGGTGGACCTGGTGAAGAGGTACAAGAAAGCCAT
C
ACGCTGGCCATCGGAGATGGGGCCAATGACGTGAACATGATCAAAACTGCCCACATTGGCGTTGGAATA
AGT
GGACAAGAAGGAATGCAAGCTGTCATGTCGAGTGACTATTCCTTTGCTCAGTTCCGATATCTGCAGA
GG
CTACTGCTGGTGCATGGCCGATGGTCTTACATAAGGATGTGCAAGTTCCTACGATACTTCTTTTACAA
A
AACTTTGCCTTTACTTTGGTTCATTTCTGGTACTCCTTCTTCAATGGCTACTCTGCGCAGACTGCATAC
GAG
GATTGGTTCATCACCCTCTACAACGTGCTGTACACCAGCCTGCCCGTGCTCCTCATGGGGCTGCTCG
AC
CAGGATGTGAGTGACAAACTGAGCCTCCGATTCCCTGGGTTATACATAGTGGGACAAAGAGACTTACT
A
TTCAACTATAAGAGATTCTTTGTAAGCTTGTTGCATGGGGTCCTAACATCGATGATCCTCTTCTTCATA
CCT
CTTGGAGCTTATCTGCAAACCGTAGGGCAGGATGGAGAGGCACCTTCCGACTACCAGTCTTTTGCCG
TC
ACCATTGCCTCTGCTCTTGTAATAACAGTCAATTTCCAGATTGGCTTGGATACTTCTTATTGGACTTT
T
GTGAATGCTTTTTCAATTTTTGGAAGCATTGCACTTTATTTTGGCATCATGTTTGACTTTCATAGTGCT
GGA
ATACATGTTCTCTTTCCATCTGCATTTCAATTTACAGGCACAGCTTCAAACGCTCTGAGACAGCCAT
AC
ATTTGGTTAACTATCATCCTGGCTGTTGCTGTGTGCTTACTACCCGTCGTTGCCATTCGATTCCTGTC
A
ATGACCATCTGGCCATCAGAAAGTGATAAGATCCAGAAGCATCGCAAGCGGTTGAAGGCGGAGGAGCAG
TGG
CAGCGACGGCAGCAGGTGTTCCGCCGGGGCGTGTCAACGCGGCGCTCGGCCTACGCCTTCTCGCACC
AG
CGGGGCTACGCGGACCTCATCTCCTCCGGGCGCAGCATCCGCAAGAAGCGCTCGCCGCTTGATGCCAT
C
GTGGCGGATGGCACCGCGGAGTACAGGCGCACCGGGGACAGCTGA


Translation (1251 aa):
MSTERDSETTFDEDSQPNDEVVPYSDDETEDELDDQGSAVEPEQNRVNREAEENREPFRKECTWQVKAND
R
KYHEQPHFMNTKFLCIKESKYA
NNAIKTYKYNAFTFIPMNLFEQFKRAANLYFLALLILQAVPQISTLA
W
YTTLVPLLVVLGVTAIKDLVDDV
ARHKMDKEINNRTCEVIKDGRFKVAKWKEIQVGDVIRLKKNDFVPA
D
ILLLSSSEPNSLCYVETAELD
GETNLKFKMSLEITDQYLQREDTLATFDGFIECEEPNNRLDKFTGTLF
W
RNTSFPLDADKILLRGCVIRNTDFCHGLVIFA
GADTKIMKNSGKTRFKRTKIDYLMNYMVYTIFVVLIL
L
SAGLAIGHAYWEAQVGNSSWYLYDGEDDTPSYRGFLIFWGYIIVLNTMVPISLYV
SVEVIRLGQSHFIN
W
DLQMYYAEKDTPAKARTTTLNEQLGQIHYIFSDKTGTLTQNIMTFKKCCINGQIY
GDHRDASQHNHNKI
E
QVDFSWNTYADGKLAFYDHYLIEQIQSGKEPEVRQFFFLLAVCHTVMVDRTDGQLNYQAASPDEGALVN
A
ARNFGFAFLARTQNTITISELGTERTYNVLAILDFNSDRKRMSII
VRTPEGNIKLYCKGADTVIYERLH
R
MNPTKQETQDALD
IFANETLRTLCLCYKEIEEKEFTEWNKKFMAASVASTNRDEALDKVYEEIEKDLIL
L
GATAIEDKLQDGVPETISKLAKADIKIWVLTGDKK
ETAENIGFACELLTEDTTICYGEDINSLLHARME
N
QRNRGGVYAKFAPPVQESFFPPGGNRALIITGSWL
NEILLEKKTKRNKILKLKFPRTEEERRMRTQSKR
R
LEAKKEQRQKNFVDLACECSAVICCRVTPKQKAMVVDLVKRYKKAITLAIGDGANDVNMIK
TAHIGVGI
S
GQEGMQAVMSSDYSFAQFRYLQRLLLVHGRWSYIRMCKFLRYFFYKNFAFTLVHFWYSFFNGYSAQ
TAY
E
DWFITLYNVLYTSLPVLLMGLLDQ
DVSDKLSLRFPGLYIVGQRDLLFNYKRFFVSLLHGVLTSMILFFI
P
LGAYLQTVGQDGEAPSDYQSFAVTIASALVITVNFQ
IGLDTSYWTFVNAFSIFGSIALYFGIMFDFHSA
G
IHVLFPSAFQFT
GTASNALRQPYIWLTIILAVAVCLLPVVAIRFLSMTIWPSESDKIQKHRKRLKAEEQ
W
QRRQQVFRRGVSTRRSAYAFSHQRGYADLISSGRSIRKKRSPLDAIVADGTAEYRRTGDS




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser