NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS11950.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
11950.1 Public Homo sapiens 18 SMAD4 22 109 92 CCDS HistoryNCBI Gene:4089Re-query CCDS DB by CCDS ID:11950.1Re-query CCDS DB by GeneID:4089See the combined annotation on chromosome 18 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 11950.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000342988.7 ENSP00000341551.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000342988.7Link to Ensembl Protein Viewer:ENSP00000341551.3Re-query CCDS DB by Nucleotide ID:ENST00000342988Re-query CCDS DB by Protein ID:ENSP00000341551
Original member Current member EBI ENST00000398417.6 ENSP00000381452.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000398417.6Link to Ensembl Protein Viewer:ENSP00000381452.1Re-query CCDS DB by Nucleotide ID:ENST00000398417Re-query CCDS DB by Protein ID:ENSP00000381452
Original member NCBI NM_005359.5 NP_005350.1 Updated not alive Link to Nucleotide Sequence:NM_005359.5Link to Protein Sequence:NP_005350.1Re-query CCDS DB by Nucleotide ID:NM_005359Re-query CCDS DB by Protein ID:NP_005350
Current member NCBI NM_005359.6 NP_005350.1 Accepted alive Link to Nucleotide Sequence:NM_005359.6Link to Protein Sequence:NP_005350.1Re-query CCDS DB by Nucleotide ID:NM_005359Re-query CCDS DB by Protein ID:NP_005350Link to BLAST:NP_005350.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_005350.1 552 Q13485 552 100% 0 0

Chromosomal Locations for CCDS 11950.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 18 (NC_000018.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18See the combined annotation on chromosome 18 in Sequence Viewer

Chromosome Start Stop Links
18 51047047 51047295 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 51048686 51048860 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 51049295 51049324 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 51054781 51054993 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 51058125 51058244 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 51058340 51058456 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 51059866 51059916 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 51065423 51065606 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 51067019 51067187 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 51076638 51076776 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 51078256 51078467 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1659 nt):
ATGGACAATATGTCTATTACGAATACACCAACAAGTAATGATGCCTGTCTGAGCATTGTGCATAGTTTGA
TG
TGCCATAGACAAGGTGGAGAGAGTGAAACATTTGCAAAAAGAGCAATTGAAAGTTTGGTAAAGAAGCT
G
AAGGAGAAAAAAGATGAATTGGATTCTTTAATAACAGCTATAACTACAAATGGAGCTCATCCTAGTAAA
TGT
GTTACCATACAGAGAACATTGGATGGGAGGCTTCAGGTGGCTGGTCGGAAAGGATTTCCTCATGTGA
TC
TATGCCCGTCTCTGGAGGTGGCCTGATCTTCACAAAAATGAACTAAAACATGTTAAATATTGTCAGTA
T
GCGTTTGACTTAAAATGTGATAGTGTCTGTGTGAATCCATATCACTACGAACGAGTTGTATCACCTGGA
ATT
GATCTCTCAGGATTAACACTGCAGAGTAATGCTCCATCAAGTATGATGGTGAAGGATGAATATGTGC
AT
GACTTTGAGGGACAGCCATCGTTGTCCACTGAAGGACATTCAATTCAAACCATCCAGCATCCACCAAG
T
AATCGTGCATCGACAGAGACATACAGCACCCCAGCTCTGTTAGCCCCATCTGAGTCTAATGCTACCAGC
ACT
GCCAACTTTCCCAACATTCCTGTGGCTTCCACAAGTCAGCCTGCCAGTATACTGGGGGGCAGCCATA
GT
GAAGGACTGTTGCAGATAGCATCAGGGCCTCAGCCAGGACAGCAGCAGAATGGATTTACTGGTCAGCC
A
GCTACTTACCATCATAACAGCACTACCACCTGGACTGGAAGTAGGACTGCACCATACACACCTAATTTG
CCT
CACCACCAAAACGGCCATCTTCAGCACCACCCGCCTATGCCGCCCCATCCCGGACATTACTGGCCTG
TT
CACAATGAGCTTGCATTCCAGCCTCCCATTTCCAATCATCCTGCTCCTGAGTATTGGTGTTCCATTGC
T
TACTTTGAAATGGATGTTCAGGTAGGAGAGACATTTAAGGTTCCTTCAAGCTGCCCTATTGTTACTGTT
GAT
GGATACGTGGACCCTTCTGGAGGAGATCGCTTTTGTTTGGGTCAACTCTCCAATGTCCACAGGACAG
AA
GCCATTGAGAGAGCAAGGTTGCACATAGGCAAAGGTGTGCAGTTGGAATGTAAAGGTGAAGGTGATGT
T
TGGGTCAGGTGCCTTAGTGACCACGCGGTCTTTGTACAGAGTTACTACTTAGACAGAGAAGCTGGGCGT
GCA
CCTGGAGATGCTGTTCATAAGATCTACCCAAGTGCATATATAAAGGTCTTTGATTTGCGTCAGTGTC
AT
CGACAGATGCAGCAGCAGGCGGCTACTGCACAAGCTGCAGCAGCTGCCCAGGCAGCAGCCGTGGCAGG
A
AACATCCCTGGCCCAGGATCAGTAGGTGGAATAGCTCCAGCTATCAGTCTGTCAGCTGCTGCTGGAATT
GGT
GTTGATGACCTTCGTCGCTTATGCATACTCAGGATGAGTTTTGTGAAAGGCTGGGGACCGGATTACC
CA
AGACAGAGCATCAAAGAAACACCTTGCTGGATTGAAATTCACTTACACCGGGCCCTCCAGCTCCTAGA
C
GAAGTACTTCATACCATGCCGATTGCAGACCCACAACCTTTAGACTGA


Translation (552 aa):
MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITAITTNGAHPSK
C
VTIQRTLDGRLQ
VAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFDLKCDSVCVNPYHYERVVSPG
I
DLSGLTLQSNAPSSMMVKDEYVHDFEGQPSLSTEGHSIQTIQHPPSNRASTETYSTPALLAPSESNATS
T
ANFPNIPVAST
SQPASILGGSHSEGLLQIASGPQPGQQQNGFTGQPATYHHNSTTTWTGSRTAPYTPNL
P
HHQNGHLQHHPPMPPHPGHY
WPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTV
D
GYVDPSGGDRFCLGQLSNVHRTEAIERA
RLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGR
A
PGDAVHKIYPSAYIK
VFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAPAISLSAAAGI
G
VDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVLHTMPIADPQPLD




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser