NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS11804.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
11804.1 Public Homo sapiens 17 SLC16A3 22 109 92 CCDS HistoryNCBI Gene:9123Re-query CCDS DB by CCDS ID:11804.1Re-query CCDS DB by GeneID:9123See the combined annotation on chromosome 17 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 11804.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000392339.5 ENSP00000376150.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000392339.5Link to Ensembl Protein Viewer:ENSP00000376150.1Re-query CCDS DB by Nucleotide ID:ENST00000392339Re-query CCDS DB by Protein ID:ENSP00000376150
Original member Current member EBI ENST00000392341.5 ENSP00000376152.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000392341.5Link to Ensembl Protein Viewer:ENSP00000376152.1Re-query CCDS DB by Nucleotide ID:ENST00000392341Re-query CCDS DB by Protein ID:ENSP00000376152
Original member Current member EBI ENST00000582743.5 ENSP00000462405.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000582743.5Link to Ensembl Protein Viewer:ENSP00000462405.1Re-query CCDS DB by Nucleotide ID:ENST00000582743Re-query CCDS DB by Protein ID:ENSP00000462405
Original member Current member EBI ENST00000581287.5 ENSP00000463978.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000581287.5Link to Ensembl Protein Viewer:ENSP00000463978.1Re-query CCDS DB by Nucleotide ID:ENST00000581287Re-query CCDS DB by Protein ID:ENSP00000463978
Original member Current member EBI ENST00000619321.1 ENSP00000482013.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000619321.1Link to Ensembl Protein Viewer:ENSP00000482013.1Re-query CCDS DB by Nucleotide ID:ENST00000619321Re-query CCDS DB by Protein ID:ENSP00000482013
Original member Current member EBI ENST00000617373.4 ENSP00000483212.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000617373.4Link to Ensembl Protein Viewer:ENSP00000483212.1Re-query CCDS DB by Nucleotide ID:ENST00000617373Re-query CCDS DB by Protein ID:ENSP00000483212
Original member NCBI NM_001042422.2 NP_001035887.1 Updated not alive Link to Nucleotide Sequence:NM_001042422.2Link to Protein Sequence:NP_001035887.1Re-query CCDS DB by Nucleotide ID:NM_001042422Re-query CCDS DB by Protein ID:NP_001035887
Current member NCBI NM_001042422.3 NP_001035887.1 Accepted alive Link to Nucleotide Sequence:NM_001042422.3Link to Protein Sequence:NP_001035887.1Re-query CCDS DB by Nucleotide ID:NM_001042422Re-query CCDS DB by Protein ID:NP_001035887Link to BLAST:NP_001035887.1
Original member NCBI NM_001042423.2 NP_001035888.1 Updated not alive Link to Nucleotide Sequence:NM_001042423.2Link to Protein Sequence:NP_001035888.1Re-query CCDS DB by Nucleotide ID:NM_001042423Re-query CCDS DB by Protein ID:NP_001035888
Current member NCBI NM_001042423.3 NP_001035888.1 Accepted alive Link to Nucleotide Sequence:NM_001042423.3Link to Protein Sequence:NP_001035888.1Re-query CCDS DB by Nucleotide ID:NM_001042423Re-query CCDS DB by Protein ID:NP_001035888Link to BLAST:NP_001035888.1
Original member NCBI NM_001206950.1 NP_001193879.1 Updated not alive Link to Nucleotide Sequence:NM_001206950.1Link to Protein Sequence:NP_001193879.1Re-query CCDS DB by Nucleotide ID:NM_001206950Re-query CCDS DB by Protein ID:NP_001193879
Current member NCBI NM_001206950.2 NP_001193879.1 Accepted alive Link to Nucleotide Sequence:NM_001206950.2Link to Protein Sequence:NP_001193879.1Re-query CCDS DB by Nucleotide ID:NM_001206950Re-query CCDS DB by Protein ID:NP_001193879Link to BLAST:NP_001193879.1
Original member NCBI NM_001206951.1 NP_001193880.1 Updated not alive Link to Nucleotide Sequence:NM_001206951.1Link to Protein Sequence:NP_001193880.1Re-query CCDS DB by Nucleotide ID:NM_001206951Re-query CCDS DB by Protein ID:NP_001193880
Current member NCBI NM_001206951.2 NP_001193880.1 Accepted alive Link to Nucleotide Sequence:NM_001206951.2Link to Protein Sequence:NP_001193880.1Re-query CCDS DB by Nucleotide ID:NM_001206951Re-query CCDS DB by Protein ID:NP_001193880Link to BLAST:NP_001193880.1
Original member NCBI NM_001206952.1 NP_001193881.1 Updated not alive Link to Nucleotide Sequence:NM_001206952.1Link to Protein Sequence:NP_001193881.1Re-query CCDS DB by Nucleotide ID:NM_001206952Re-query CCDS DB by Protein ID:NP_001193881
Current member NCBI NM_001206952.2 NP_001193881.1 Accepted alive Link to Nucleotide Sequence:NM_001206952.2Link to Protein Sequence:NP_001193881.1Re-query CCDS DB by Nucleotide ID:NM_001206952Re-query CCDS DB by Protein ID:NP_001193881Link to BLAST:NP_001193881.1
Original member NCBI NM_004207.3 NP_004198.1 Updated not alive Link to Nucleotide Sequence:NM_004207.3Link to Protein Sequence:NP_004198.1Re-query CCDS DB by Nucleotide ID:NM_004207Re-query CCDS DB by Protein ID:NP_004198
Current member NCBI NM_004207.4 NP_004198.1 Accepted alive Link to Nucleotide Sequence:NM_004207.4Link to Protein Sequence:NP_004198.1Re-query CCDS DB by Nucleotide ID:NM_004207Re-query CCDS DB by Protein ID:NP_004198Link to BLAST:NP_004198.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001035887.1 465 O15427 465 100% 0 0
NP_001035888.1 465 O15427 465 100% 0 0
NP_001193879.1 465 O15427 465 100% 0 0
NP_001193880.1 465 O15427 465 100% 0 0
NP_001193881.1 465 O15427 465 100% 0 0
NP_004198.1 465 O15427 465 100% 0 0

Chromosomal Locations for CCDS 11804.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 17 (NC_000017.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17See the combined annotation on chromosome 17 in Sequence Viewer

Chromosome Start Stop Links
17 82236009 82236231 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 82236729 82236872 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 82237138 82237893 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 82238702 82238976 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1398 nt):
ATGGGAGGGGCCGTGGTGGACGAGGGCCCCACAGGCGTCAAGGCCCCTGACGGCGGCTGGGGCTGGGCCG
TG
CTCTTCGGCTGTTTCGTCATCACTGGCTTCTCCTACGCCTTCCCCAAGGCCGTCAGTGTCTTCTTCAA
G
GAGCTCATACAGGAGTTTGGGATCGGCTACAGCGACACAGCCTGGATCTCCTCCATCCTGCTGGCCATG
CTC
TACGGGACAGGTCCGCTCTGCAGTGTGTGCGTGAACCGCTTTGGCTGCCGGCCCGTCATGCTTGTGG
GG
GGTCTCTTTGCGTCGCTGGGCATGGTGGCTGCGTCCTTTTGCCGGAGCATCATCCAGGTCTACCTCAC
C
ACTGGGGTCATCACGGGGTTGGGTTTGGCACTCAACTTCCAGCCCTCGCTCATCATGCTGAACCGCTAC
TTC
AGCAAGCGGCGCCCCATGGCCAACGGGCTGGCGGCAGCAGGTAGCCCTGTCTTCCTGTGTGCCCTGA
GC
CCGCTGGGGCAGCTGCTGCAGGACCGCTACGGCTGGCGGGGCGGCTTCCTCATCCTGGGCGGCCTGCT
G
CTCAACTGCTGCGTGTGTGCCGCACTCATGAGGCCCCTGGTGGTCACGGCCCAGCCGGGCTCGGGGCCG
CCG
CGACCCTCCCGGCGCCTGCTAGACCTGAGCGTCTTCCGGGACCGCGGCTTTGTGCTTTACGCCGTGG
CC
GCCTCGGTCATGGTGCTGGGGCTCTTCGTCCCGCCCGTGTTCGTGGTGAGCTACGCCAAGGACCTGGG
C
GTGCCCGACACCAAGGCCGCCTTCCTGCTCACCATCCTGGGCTTCATTGACATCTTCGCGCGGCCGGCC
GCG
GGCTTCGTGGCGGGGCTTGGGAAGGTGCGGCCCTACTCCGTCTACCTCTTCAGCTTCTCCATGTTCT
TC
AACGGCCTCGCGGACCTGGCGGGTTCTACGGCGGGCGACTACGGCGGCCTCGTGGTCTTCTGCATCTT
C
TTTGGCATCTCCTACGGCATGGTGGGGGCCCTGCAGTTCGAGGTGCTCATGGCCATCGTGGGCACCCAC
AAG
TTCTCCAGTGCCATTGGCCTGGTGCTGCTGATGGAGGCGGTGGCCGTGCTCGTCGGGCCCCCTTCGG
GA
GGCAAACTCCTGGATGCGACCCACGTCTACATGTACGTGTTCATCCTGGCGGGGGCCGAGGTGCTCAC
C
TCCTCCCTGATTTTGCTGCTGGGCAACTTCTTCTGCATTAGGAAGAAGCCCAAAGAGCCACAGCCTGAG
GTG
GCGGCCGCGGAGGAGGAGAAGCTCCACAAGCCTCCTGCAGACTCGGGGGTGGACTTGCGGGAGGTGG
AG
CATTTCCTGAAGGCTGAGCCTGAGAAAAACGGGGAGGTGGTTCACACCCCGGAAACAAGTGTCTGA


Translation (465 aa):
MGGAVVDEGPTGVKAPDGGWGWAVLFGCFVITGFSYAFPKAVSVFFKELIQEFGIGYSDTAWISSILLAM
L
YGT
GPLCSVCVNRFGCRPVMLVGGLFASLGMVAASFCRSIIQVYLTTGVITGLGLALNFQPSLIMLNRY
F
SKRRPMANGLAAAGSPVFLCALSPLGQLLQDRYGWRGGFLILGGLLLNCCVCAALMRPLVVTAQPGSGP
P
RPSRRLLDLSVFRDRGFVLYAVAASVMVLGLFVPPVFVVSYAKDLGVPDTKAAFLLTILGFIDIFARPA
A
GFVAGLGKVRPYSVYLFSFSMFFNGLADLAGSTAGDYGGLVVFCIFFGISYGMVGALQFEVLMAIVGTH
K
FSSAIGLVLLMEAVAVLVGPPSG
GKLLDATHVYMYVFILAGAEVLTSSLILLLGNFFCIRKKPKEPQPE
V
AAAEEEKLHKPPADSGVDLREVEHFLKAEPEKNGEVVHTPETSV




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser