NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS11622.2 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
11622.2 Public Homo sapiens 17 RNFT1 22 109 92 CCDS HistoryNCBI Gene:51136Re-query CCDS DB by CCDS ID:11622.2Re-query CCDS DB by GeneID:51136See the combined annotation on chromosome 17 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)

Sequence IDs included in CCDS 11622.2

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000305783.12 ENSP00000304670.8 Accepted alive Link to Ensembl Transcript Viewer:ENST00000305783.12Link to Ensembl Protein Viewer:ENSP00000304670.8Re-query CCDS DB by Nucleotide ID:ENST00000305783Re-query CCDS DB by Protein ID:ENSP00000304670
Original member NCBI NM_016125.3 NP_057209.3 Updated not alive Link to Nucleotide Sequence:NM_016125.3Link to Protein Sequence:NP_057209.3Re-query CCDS DB by Nucleotide ID:NM_016125Re-query CCDS DB by Protein ID:NP_057209
Current member NCBI NM_016125.4 NP_057209.3 Accepted alive Link to Nucleotide Sequence:NM_016125.4Link to Protein Sequence:NP_057209.3Re-query CCDS DB by Nucleotide ID:NM_016125Re-query CCDS DB by Protein ID:NP_057209Link to BLAST:NP_057209.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_057209.3 435 Q5M7Z0-1 435 100% 0 0

Chromosomal Locations for CCDS 11622.2

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 17 (NC_000017.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17See the combined annotation on chromosome 17 in Sequence Viewer

Chromosome Start Stop Links
17 59952977 59953111 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 59954045 59954146 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 59956488 59956553 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 59957224 59957382 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 59958291 59958444 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 59960068 59960168 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 59962540 59962616 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 59962827 59963284 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 59964608 59964663 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1308 nt):
ATGCCGCTGTTCTTGCTGTCGCTCCCGACACCTCCGTCCGCTTCTGGTCATGAGAGGAGACAGAGGCCTG
AA
GCAAAGACATCTGGGTCAGAGAAAAAGTATTTAAGGGCCATGCAAGCCAATCGTAGCCAACTGCACAG
T
CCTCCAGGAACTGGAAGCAGTGAGGATGCCTCAACCCCTCAGTGTGTCCACACAAGATTGACAGGAGAG
GGT
TCTTGCCCTCATTCTGGAGATGTTCATATCCAGATAAACTCCATACCTAAAGAATGTGCAGAAAATG
CA
AGCTCCAGAAATATAAGGTCAGGTGTCCATAGCTGTGCCCATGGATGTGTACACAGTCGCTTACGGGG
T
CACTCCCACAGTGAAGCAAGGCTGACTGATGATACTGCCGCAGAATCTGGAGATCATGGTAGTAGCTCC
TTC
TCAGAATTCCGCTATCTCTTCAAGTGGCTGCAAAAAAGTCTTCCATATATTTTGATTCTGAGCGTCA
AA
CTTGTTATGCAGCATATAACAGGAATTTCTCTTGGAATTGGGCTGCTAACAACTTTTATGTATGCAAA
C
AAAAGCATTGTAAATCAGGTTTTTCTAAGAGAAAGGTCCTCAAAGATTCAGTGTGCTTGGTTACTGGTA
TTC
TTAGCAGGATCTTCTGTTCTTTTATATTACACCTTTCATTCTCAGTCACTTTATTACAGCTTAATTT
TT
TTAAATCCTACTTTGGACCATTTGAGCTTCTGGGAAGTATTTTGGATTGTTGGAATTACAGACTTCAT
T
CTGAAATTCTTTTTCATGGGCTTAAAATGCCTTATTTTATTGGTGCCTTCTTTCATCATGCCTTTTAAA
TCT
AAGGGTTACTGGTATATGCTTTTAGAAGAATTGTGTCAATACTACCGAACTTTTGTTCCCATACCAG
TT
TGGTTTCGCTACCTTATAAGCTATGGGGAGTTTGGTAACGTAACTAGATGGAGTCTTGGGATACTGCT
G
GCTTTACTCTACCTCATATTAAAACTTTTGGAATTTTTTGGGCATCTGAGAACTTTCAGACAGGTTTTA
CGA
ATATTTTTTACACAACCAAGTTATGGAGTGGCTGCCAGCAAGAGACAGTGTTCAGATGTGGATGATA
TT
TGTTCAATATGTCAAGCTGAATTTCAGAAGCCAATTCTTCTCATTTGTCAGCATATATTTTGTGAAGA
G
TGCATGACCTTATGGTTTAACAGAGAGAAAACATGTCCACTCTGCAGAACTGTGATTTCAGACCATATA
AAC
AAATGGAAGGATGGAGCCACTTCATCACACCTTCAAATATATTAA


Translation (435 aa):
MPLFLLSLPTPPSASGHERRQRPEAKTSGSEKKYLRAMQANRSQLHSPPGTGSSEDASTPQCVHTRLTGE
G
SCPHSGDVHIQINSIPKECAENASSRNIRSGVHSCAHGCVHSRLRGHSHSEARLTDDTAAESGDHGSSS
F
SEFRYLFKWLQKSLPYILILSVKLVMQHIT
GISLGIGLLTTFMYANKSIVNQVFLRERSSKIQCAWLLV
F
LAGSSVLLYYTFHSQSLYY
SLIFLNPTLDHLSFWEVFWIVGITDFILKFFFMGLKCLILLVPSFIMPFK
S
K
GYWYMLLEELCQYYRTFVPIPVWFRYLISYGEFGNVTRWSLGILLALLYLILKLLEFFGHLRTFRQVL
R
IFFTQP
SYGVAASKRQCSDVDDICSICQAEFQKPILLICQHIFCEECMTLWFNREKTCPLCRTVISDHI
N
KWKDGATSSHLQIY




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser