NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS11604.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
11604.1 Public Homo sapiens 17 MPO 22 109 92 CCDS HistoryNCBI Gene:4353Re-query CCDS DB by CCDS ID:11604.1Re-query CCDS DB by GeneID:4353See the combined annotation on chromosome 17 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 11604.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000225275.3 ENSP00000225275.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000225275.3Link to Ensembl Protein Viewer:ENSP00000225275.3Re-query CCDS DB by Nucleotide ID:ENST00000225275Re-query CCDS DB by Protein ID:ENSP00000225275
Original member NCBI NM_000250.1 NP_000241.1 Updated not alive Link to Nucleotide Sequence:NM_000250.1Link to Protein Sequence:NP_000241.1Re-query CCDS DB by Nucleotide ID:NM_000250Re-query CCDS DB by Protein ID:NP_000241
Current member NCBI NM_000250.2 NP_000241.1 Accepted alive Link to Nucleotide Sequence:NM_000250.2Link to Protein Sequence:NP_000241.1Re-query CCDS DB by Nucleotide ID:NM_000250Re-query CCDS DB by Protein ID:NP_000241Link to BLAST:NP_000241.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_000241.1 745 P05164-1 745 100% 0 0

Chromosomal Locations for CCDS 11604.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 17 (NC_000017.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17See the combined annotation on chromosome 17 in Sequence Viewer

Chromosome Start Stop Links
17 58270656 58270863 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 58271655 58271892 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 58272748 58272918 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 58273414 58273669 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 58275542 58275702 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 58277827 58278145 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 58279008 58279214 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 58279297 58279426 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 58279523 58279646 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 58279839 58280014 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 58280366 58280459 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 58280605 58280758 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2238 nt):
ATGGGGGTTCCCTTCTTCTCTTCTCTCAGATGCATGGTGGACTTAGGACCTTGCTGGGCTGGGGGTCTCA
CT
GCAGAGATGAAGCTGCTTCTGGCCCTAGCAGGGCTCCTGGCCATTCTGGCCACGCCCCAGCCCTCTGA
A
GGTGCTGCTCCAGCTGTCCTGGGGGAGGTGGACACCTCGTTGGTGCTGAGCTCCATGGAGGAGGCCAAG
CAG
CTGGTGGACAAGGCCTACAAGGAGCGGCGGGAAAGCATCAAGCAGCGGCTTCGCAGCGGCTCAGCCA
GC
CCCATGGAACTCCTATCCTACTTCAAGCAGCCGGTGGCAGCCACCAGGACGGCGGTGAGGGCCGCTGA
C
TACCTGCACGTGGCTCTAGACCTGCTGGAGAGGAAGCTGCGGTCCCTGTGGCGAAGGCCATTCAATGTC
ACT
GATGTGCTGACGCCCGCCCAGCTGAATGTGTTGTCCAAGTCAAGCGGCTGCGCCTACCAGGACGTGG
GG
GTGACTTGCCCGGAGCAGGACAAATACCGCACCATCACCGGGATGTGCAACAACAGACGCAGCCCCAC
G
CTGGGGGCCTCCAACCGTGCCTTTGTGCGCTGGCTGCCGGCGGAGTATGAGGACGGCTTCTCTCTTCCC
TAC
GGCTGGACGCCCGGGGTCAAGCGCAACGGCTTCCCGGTGGCTCTGGCTCGCGCGGTCTCCAACGAGA
TC
GTGCGCTTCCCCACTGATCAGCTGACTCCGGACCAGGAGCGCTCACTCATGTTCATGCAATGGGGCCA
G
CTGTTGGACCACGACCTCGACTTCACCCCTGAGCCGGCCGCCCGGGCCTCCTTCGTCACTGGCGTCAAC
TGC
GAGACCAGCTGCGTTCAGCAGCCGCCCTGCTTCCCGCTCAAGATCCCGCCCAATGACCCCCGCATCA
AG
AACCAAGCCGACTGCATCCCGTTCTTCCGCTCCTGCCCGGCTTGCCCCGGGAGCAACATCACCATCCG
C
AACCAGATCAACGCGCTCACTTCCTTCGTGGACGCCAGCATGGTGTACGGCAGCGAGGAGCCCCTGGCC
AGG
AACCTGCGCAACATGTCCAACCAGCTGGGGCTGCTGGCCGTCAACCAGCGCTTCCAAGACAACGGCC
GG
GCCCTGCTGCCCTTTGACAACCTGCACGATGACCCCTGTCTCCTCACCAACCGCTCAGCGCGCATCCC
C
TGCTTCCTGGCAGGGGACACCCGTTCCAGTGAGATGCCCGAGCTCACCTCCATGCACACCCTCTTACTT
CGG
GAGCACAACCGGCTGGCCACAGAGCTCAAGAGCCTGAACCCTAGGTGGGATGGGGAGAGGCTCTACC
AG
GAAGCCCGGAAGATCGTGGGGGCCATGGTCCAGATCATCACTTACCGGGACTACCTGCCCCTGGTGCT
G
GGGCCAACGGCCATGAGGAAGTACCTGCCCACGTACCGTTCCTACAATGACTCAGTGGACCCACGCATC
GCC
AACGTCTTCACCAATGCCTTCCGCTACGGCCACACCCTCATCCAACCCTTCATGTTCCGCCTGGACA
AT
CGGTACCAGCCCATGGAACCCAACCCCCGTGTCCCCCTCAGCAGGGTCTTTTTTGCCTCCTGGAGGGT
C
GTGCTGGAAGGTGGCATTGACCCCATCCTCCGGGGCCTCATGGCCACCCCTGCCAAGCTGAATCGTCAG
AAC
CAAATTGCAGTGGATGAGATCCGGGAGCGATTGTTTGAGCAGGTCATGAGGATTGGGCTGGACCTGC
CT
GCTCTGAACATGCAGCGCAGCAGGGACCACGGCCTCCCAGGATACAATGCCTGGAGGCGCTTCTGTGG
G
CTCCCGCAGCCTGAAACTGTGGGCCAGCTGGGCACGGTGCTGAGGAACCTGAAATTGGCGAGGAAACTG
ATG
GAGCAGTATGGCACGCCCAACAACATCGACATCTGGATGGGCGGCGTGTCCGAGCCTCTGAAGCGCA
AA
GGCCGCGTGGGCCCACTCCTCGCCTGCATCATCGGTACCCAGTTCAGGAAGCTCCGGGATGGTGATCG
G
TTTTGGTGGGAGAACGAGGGTGTGTTCAGCATGCAGCAGCGACAGGCCCTGGCCCAGATCTCATTGCCC
CGG
ATCATCTGCGACAACACAGGCATCACCACCGTGTCTAAGAACAACATCTTCATGTCCAACTCATATC
CC
CGGGACTTTGTCAACTGCAGTACACTTCCTGCATTGAACCTGGCTTCCTGGAGGGAAGCCTCCTAG


Translation (745 aa):
MGVPFFSSLRCMVDLGPCWAGGLTAEMKLLLALAGLLAILATPQPSEGAAPAVLGEVDTSLVLSSMEEAK
Q
LVDKAYKERRE
SIKQRLRSGSASPMELLSYFKQPVAATRTAVRAADYLHVALDLLERKLRSLWRRPFNV
T
DVLTPAQLNVLSKSSGCAYQDVGVTCPEQDKYRTITGMCNNRRSPTLGASNRAFVRWLPAEYEDGFSLP
Y
GWTPGVKRNGFPVAL
ARAVSNEIVRFPTDQLTPDQERSLMFMQWGQLLDHDLDFTPEPAARASFVTGVN
C
ETSCVQQPPCFPLK
IPPNDPRIKNQADCIPFFRSCPACPGSNITIRNQINALTSFVDASMVYGSEEPLA
R
NLRNMSNQLGLLAVNQRFQDNGRALLPFDNLHDDPCLLTNRSARIPCFLA
GDTRSSEMPELTSMHTLLL
R
EHNRLATELKSLNPRWDGERLYQEARKIVGAMVQ
IITYRDYLPLVLGPTAMRKYLPTYRSYNDSVDPRI
A
NVFTNAFRYGHTLIQPFMFRLDNRYQPMEPNPRVPLSRVFFASWRVVLE
GGIDPILRGLMATPAKLNRQ
N
QIAVDEIRERLFEQVMRIGLDLPALNMQRSRDHGLP
GYNAWRRFCGLPQPETVGQLGTVLRNLKLARKL
M
EQYGTPNNIDIWMGGVSEPLKRKGRVGPLLACIIGTQFRKLRDGD
RFWWENEGVFSMQQRQALAQISLP
R
IICDNTGITTVSKNNIFMSNSYPRDFVNCSTLPALNLASWREAS




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser