NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS11567.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
11567.1 Public Homo sapiens 17 ACSF2 22 109 92 CCDS HistoryNCBI Gene:80221Re-query CCDS DB by CCDS ID:11567.1Re-query CCDS DB by GeneID:80221See the combined annotation on chromosome 17 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 11567.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000300441.8 ENSP00000300441.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000300441.8Link to Ensembl Protein Viewer:ENSP00000300441.4Re-query CCDS DB by Nucleotide ID:ENST00000300441Re-query CCDS DB by Protein ID:ENSP00000300441
Original member Current member NCBI NM_025149.5 NP_079425.3 Accepted alive Link to Nucleotide Sequence:NM_025149.5Link to Protein Sequence:NP_079425.3Re-query CCDS DB by Nucleotide ID:NM_025149Re-query CCDS DB by Protein ID:NP_079425Link to BLAST:NP_079425.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_079425.3 615 Q96CM8-1 615 100% 0 0

Chromosomal Locations for CCDS 11567.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 17 (NC_000017.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17See the combined annotation on chromosome 17 in Sequence Viewer

Chromosome Start Stop Links
17 50426262 50426389 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 50460677 50460872 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 50461242 50461370 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 50461633 50461686 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 50462184 50462302 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 50462420 50462585 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 50463156 50463251 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 50463395 50463552 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 50463818 50463909 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 50464218 50464294 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 50471028 50471135 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 50472428 50472579 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 50473665 50473806 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 50473894 50474004 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 50474199 50474267 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 50474502 50474552 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1848 nt):
ATGGCTGTCTACGTCGGGATGCTGCGCCTGGGGAGGCTGTGCGCCGGGAGCTCGGGGGTGCTGGGGGCCC
GG
GCCGCCCTCTCTCGGAGTTGGCAGGAAGCCAGGTTGCAGGGTGTCCGCTTCCTCAGTTCCAGAGAGGT
G
GATCGCATGGTCTCCACGCCCATCGGAGGCCTCAGCTACGTTCAGGGGTGCACCAAAAAGCATCTTAAC
AGC
AAGACTGTGGGCCAGTGCCTGGAGACCACAGCACAGAGGGTCCCAGAACGAGAGGCCTTGGTCGTCC
TC
CATGAAGACGTCAGGTTGACCTTTGCCCAACTCAAGGAGGAGGTGGACAAAGCTGCTTCTGGCCTCCT
G
AGCATTGGCCTCTGCAAAGGTGACCGGCTGGGCATGTGGGGACCTAACTCCTATGCATGGGTGCTCATG
CAG
TTGGCCACCGCCCAGGCGGGCATCATTCTGGTGTCTGTGAACCCAGCCTACCAGGCTATGGAACTGG
AG
TATGTCCTCAAGAAGGTGGGCTGCAAGGCCCTTGTGTTCCCCAAGCAATTCAAGACCCAGCAATACTA
C
AACGTCCTGAAGCAGATCTGTCCAGAAGTGGAGAATGCCCAGCCAGGGGCCTTGAAGAGTCAGAGGCTC
CCA
GATCTGACCACAGTCATCTCGGTGGATGCCCCTTTGCCGGGGACCCTGCTCCTGGATGAAGTGGTGG
CG
GCTGGCAGCACACGGCAGCATCTGGACCAGCTCCAATACAACCAGCAGTTCCTGTCCTGCCATGACCC
C
ATCAACATCCAGTTCACCTCGGGGACAACAGGCAGCCCCAAGGGGGCCACCCTCTCCCACTACAACATT
GTC
AACAACTCCAACATTTTAGGAGAGCGCCTGAAACTGCATGAGAAGACACCAGAGCAGTTGCGGATGA
TC
CTGCCCAACCCCCTGTACCATTGCCTGGGTTCCGTGGCAGGCACAATGATGTGTCTGATGTACGGTGC
C
ACCCTCATCCTGGCCTCTCCCATCTTCAATGGCAAGAAGGCACTGGAGGCCATCAGCAGAGAGAGAGGC
ACC
TTCCTGTATGGTACCCCCACGATGTTCGTGGACATTCTGAACCAGCCAGACTTCTCCAGTTATGACA
TC
TCGACCATGTGTGGAGGTGTCATTGCTGGGTCCCCTGCACCTCCAGAGTTGATCCGAGCCATCATCAA
C
AAGATAAATATGAAGGACCTGGTGGTTGCTTATGGAACCACAGAGAACAGTCCCGTGACATTCGCGCAC
TTC
CCTGAGGACACTGTGGAGCAGAAGGCAGAAAGCGTGGGCAGAATTATGCCTCACACGGAGGCCCGGA
TC
ATGAACATGGAGGCAGGGACGCTGGCAAAGCTGAACACGCCCGGGGAGCTGTGCATCCGAGGGTACTG
C
GTCATGCTGGGCTACTGGGGTGAGCCTCAGAAGACAGAGGAAGCAGTGGATCAGGACAAGTGGTATTGG
ACA
GGAGATGTCGCCACAATGAATGAGCAGGGCTTCTGCAAGATCGTGGGCCGCTCTAAGGATATGATCA
TC
CGGGGTGGTGAGAACATCTACCCCGCAGAGCTCGAGGACTTCTTTCACACACACCCGAAGGTGCAGGA
A
GTGCAGGTGGTGGGAGTGAAGGACGATCGGATGGGGGAAGAGATTTGTGCCTGCATTCGGCTGAAGGAC
GGG
GAGGAGACCACGGTGGAGGAGATAAAAGCTTTCTGCAAAGGGAAGATCTCTCACTTCAAGATTCCGA
AG
TACATCGTGTTTGTCACAAACTACCCCCTCACCATTTCAGGAAAGATCCAGAAATTCAAACTTCGAGA
G
CAGATGGAACGACATCTAAATCTGTGA


Translation (615 aa):
MAVYVGMLRLGRLCAGSSGVLGARAALSRSWQEARLQGVRFLSSREVDRMVSTPIGGLSYVQGCTKKHLN
S
KTVGQCLETTAQRVPEREALVVLHEDVRLTFAQLKEE
VDKAASGLLSIGLCKGDRLGMWGPNSYAWVLM
Q
LATAQAGIIL
VSVNPAYQAMELEYVLKKVGCKALVFPKQFKTQQYYNVLKQICPEVENAQPGALKSQRL
P
DLTTVISVDAPLPGTLLLDEVVAAGSTRQHLDQLQYNQQFLSCHDPINIQFTS
GTTGSPKGATLSHYNI
V
NNSNILGERLKLHEK
TPEQLRMILPNPLYHCLGSVAGTMMCLMYGATLILASPIFNGKKALEAISRERG
T
FLYGTPTMFVDILNQPDFSSYDISTMCG
GVIAGSPAPPELIRAIINKINMKDLVVAYGTTENSPVTFAH
F
PEDTVEQKAESVGRIMPHTE
ARIMNMEAGTLAKLNTPGELCIRGYCVMLGYWGEPQKTEEAVDQDKWYW
T
GDVATMNEQGFCKIVGRSKDMIIRGGENIYPAELEDFFHTHPKVQEVQVVGVKDDRMGEEICACIRLKD
G
EETTVEEIKAFCKGK
ISHFKIPKYIVFVTNYPLTISGKIQKFKLREQMERHLNL



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser