NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS11547.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
11547.1 Public Homo sapiens 17 PHOSPHO1 22 109 92 CCDS HistoryNCBI Gene:162466Re-query CCDS DB by CCDS ID:11547.1Re-query CCDS DB by GeneID:162466See the combined annotation on chromosome 17 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 11547.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000310544.8 ENSP00000311925.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000310544.8Link to Ensembl Protein Viewer:ENSP00000311925.4Re-query CCDS DB by Nucleotide ID:ENST00000310544Re-query CCDS DB by Protein ID:ENSP00000311925
Original member NCBI NM_178500.3 NP_848595.1 Updated not alive Link to Nucleotide Sequence:NM_178500.3Link to Protein Sequence:NP_848595.1Re-query CCDS DB by Nucleotide ID:NM_178500Re-query CCDS DB by Protein ID:NP_848595
Current member NCBI NM_178500.4 NP_848595.1 Accepted alive Link to Nucleotide Sequence:NM_178500.4Link to Protein Sequence:NP_848595.1Re-query CCDS DB by Nucleotide ID:NM_178500Re-query CCDS DB by Protein ID:NP_848595Link to BLAST:NP_848595.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_848595.1 267 Q8TCT1-1 267 100% 0 0

Chromosomal Locations for CCDS 11547.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 17 (NC_000017.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17See the combined annotation on chromosome 17 in Sequence Viewer

Chromosome Start Stop Links
17 49224246 49225004 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 49226647 49226691 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (804 nt):
ATGAGTGGCTGTTTTCCAGTTTCTGGCCTCCGCTGCCTATCTAGGGACGGCAGGATGGCCGCGCAGGGCG
CG
CCGCGCTTCCTCCTGACCTTCGACTTCGACGAGACTATCGTGGACGAAAACAGCGACGATTCGATCGT
G
CGCGCCGCGCCGGGCCAGCGGCTCCCGGAGAGCCTGCGAGCCACCTACCGCGAGGGCTTCTACAACGAG
TAC
ATGCAGCGCGTCTTCAAGTACCTGGGCGAGCAGGGCGTGCGGCCGCGGGACCTGAGCGCCATCTACG
AA
GCCATCCCTTTGTCGCCAGGCATGAGCGACCTGCTGCAGTTTGTGGCAAAACAGGGCGCCTGCTTCGA
G
GTGATTCTCATCTCCGATGCCAACACCTTTGGCGTGGAGAGCTCGCTGCGCGCCGCCGGCCACCACAGC
CTG
TTCCGCCGCATCCTCAGCAACCCGTCGGGGCCGGATGCGCGGGGACTGCTGGCTCTGCGGCCGTTCC
AC
ACACACAGCTGCGCGCGCTGCCCCGCCAACATGTGCAAGCACAAGGTGCTCAGCGACTACCTGCGCGA
G
CGGGCCCACGACGGCGTGCACTTCGAGCGCCTCTTCTACGTGGGCGACGGCGCCAACGACTTCTGCCCC
ATG
GGGCTGCTGGCGGGCGGCGACGTGGCCTTCCCGCGCCGCGGCTACCCCATGCACCGCCTCATTCAGG
AG
GCCCAGAAGGCCGAGCCCAGCTCGTTCCGCGCCAGCGTGGTGCCCTGGGAAACGGCTGCAGATGTGCG
C
CTCCACCTGCAACAGGTGCTGAAGTCGTGCTGA


Translation (267 aa):
MSGCFPVSGLRCLSRDGRMAAQGAPRFLLTFDFDETIVDENSDDSIVRAAPGQRLPESLRATYREGFYNE
Y
MQRVFKYLGEQGVRPRDLSAIYEAIPLSPGMSDLLQFVAKQGACFEVILISDANTFGVESSLRAAGHHS
L
FRRILSNPSGPDARGLLALRPFHTHSCARCPANMCKHKVLSDYLRERAHDGVHFERLFYVGDGANDFCP
M
GLLAGGDVAFPRRGYPMHRLIQEAQKAEPSSFRASVVPWETAADVRLHLQQVLKSC




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser