NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS11516.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
11516.1 Public Homo sapiens 17 MRPL10 24 110 108 CCDS HistoryNCBI Gene:124995Re-query CCDS DB by CCDS ID:11516.1Re-query CCDS DB by GeneID:124995See the combined annotation on chromosome 17 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 11516.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000351111.7 ENSP00000324100.4 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000351111.7Link to Ensembl Protein Viewer:ENSP00000324100.4Re-query CCDS DB by Nucleotide ID:ENST00000351111Re-query CCDS DB by Protein ID:ENSP00000324100
Original member Current member NCBI NM_145255.4 NP_660298.2 MANE Select Accepted alive Link to Nucleotide Sequence:NM_145255.4Link to Protein Sequence:NP_660298.2Re-query CCDS DB by Nucleotide ID:NM_145255Re-query CCDS DB by Protein ID:NP_660298Link to BLAST:NP_660298.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_660298.2 261 Q7Z7H8-1 261 100% 0 0

Chromosomal Locations for CCDS 11516.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 17 (NC_000017.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17See the combined annotation on chromosome 17 in Sequence Viewer

Chromosome Start Stop Links
17 47824205 47824458 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 47826637 47826781 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 47827040 47827204 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 47828501 47828670 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 47831460 47831511 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (786 nt):
ATGGCTGCGGCCGTGGCGGGGATGCTGCGAGGGGGTCTCCTGCCCCAGGCGGGCCGGCTGCCTACCCTCC
AG
ACTGTCCGCTATGGCTCCAAGGCTGTTACCCGCCACCGTCGTGTGATGCACTTTCAGCGGCAGAAGCT
G
ATGGCTGTGACTGAATATATCCCCCCGAAACCAGCCATCCACCCATCATGCCTGCCATCTCCTCCCAGC
CCC
CCACAGGAGGAGATAGGCCTCATCAGGCTTCTCCGCCGGGAGATAGCAGCAGTTTTCCAGGACAACC
GA
ATGATAGCCGTCTGCCAGAATGTGGCTCTGAGTGCAGAGGACAAGCTTCTTATGCGACACCAGCTGCG
G
AAACACAAGATCCTGATGAAGGTCTTCCCCAACCAGGTCCTGAAGCCCTTCCTGGAGGATTCCAAGTAC
CAA
AATCTGCTGCCCCTTTTTGTGGGGCACAACATGCTGCTGGTCAGTGAAGAGCCCAAGGTCAAGGAGA
TG
GTACGGATCTTAAGGACTGTGCCATTCCTGCCGCTGCTAGGTGGCTGCATTGATGACACCATCCTCAG
C
AGGCAGGGCTTTATCAACTACTCCAAGCTCCCCAGCCTGCCCCTGGTGCAGGGGGAGCTTGTAGGAGGC
CTC
ACCTGCCTCACAGCCCAGACCCACTCCCTGCTCCAGCACCAGCCCCTCCAGCTGACCACCCTGTTGG
AC
CAGTACATCAGAGAGCAACGCGAGAAGGATTCTGTCATGTCGGCCAATGGGAAGCCAGATCCTGACAC
T
GTTCCGGACTCGTAG


Translation (261 aa):
MAAAVAGMLRGGLLPQAGRLPTLQTVRYGSKAVTRHRRVMHFQRQKLMAVTEYIPPKPAIHPSCLPSPPS
P
PQE
EIGLIRLLRREIAAVFQDNRMIAVCQNVALSAEDKLLMRHQLRKHKILMKVFPNQVLKPFLEDSKY
Q
NLLPLFVGHNMLLVSEEPKVKEMVRILRTVPFLPLL
GGCIDDTILSRQGFINYSKLPSLPLVQGELVGG
L
TCLTAQTHSLLQHQPLQLTTLLDQYIREQREKDSVMSANGKPDPDTVPDS




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser