NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS11210.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
11210.1 Public Homo sapiens 17 ALDH3A2 22 109 92 CCDS HistoryNCBI Gene:224Re-query CCDS DB by CCDS ID:11210.1Re-query CCDS DB by GeneID:224See the combined annotation on chromosome 17 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 11210.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000176643.10 ENSP00000176643.6 Accepted alive Link to Ensembl Transcript Viewer:ENST00000176643.10Link to Ensembl Protein Viewer:ENSP00000176643.6Re-query CCDS DB by Nucleotide ID:ENST00000176643Re-query CCDS DB by Protein ID:ENSP00000176643
Original member Current member EBI ENST00000395575.6 ENSP00000378942.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000395575.6Link to Ensembl Protein Viewer:ENSP00000378942.2Re-query CCDS DB by Nucleotide ID:ENST00000395575Re-query CCDS DB by Protein ID:ENSP00000378942
Original member Current member EBI ENST00000579855.5 ENSP00000463637.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000579855.5Link to Ensembl Protein Viewer:ENSP00000463637.1Re-query CCDS DB by Nucleotide ID:ENST00000579855Re-query CCDS DB by Protein ID:ENSP00000463637
Original member NCBI NM_000382.2 NP_000373.1 Updated not alive Link to Nucleotide Sequence:NM_000382.2Link to Protein Sequence:NP_000373.1Re-query CCDS DB by Nucleotide ID:NM_000382Re-query CCDS DB by Protein ID:NP_000373
Current member NCBI NM_000382.3 NP_000373.1 Accepted alive Link to Nucleotide Sequence:NM_000382.3Link to Protein Sequence:NP_000373.1Re-query CCDS DB by Nucleotide ID:NM_000382Re-query CCDS DB by Protein ID:NP_000373Link to BLAST:NP_000373.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_000373.1 485 P51648-1 485 100% 0 0

Chromosomal Locations for CCDS 11210.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 17 (NC_000017.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17See the combined annotation on chromosome 17 in Sequence Viewer

Chromosome Start Stop Links
17 19648972 19649124 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 19651547 19651778 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 19652547 19652632 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 19656366 19656574 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 19657745 19657862 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 19661127 19661268 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 19663333 19663499 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 19664948 19665047 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 19671721 19671956 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 19675558 19675572 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1458 nt):
ATGGAGCTCGAAGTCCGGCGGGTCCGACAGGCGTTCCTGTCCGGCCGGTCGCGACCTCTGCGGTTTCGGC
TG
CAGCAGCTGGAGGCCCTGCGGAGGATGGTGCAGGAGCGCGAGAAGGATATCCTGACGGCCATCGCCGC
C
GACCTGTGCAAGAGTGAATTCAATGTGTACAGTCAGGAAGTCATTACTGTCCTTGGGGAAATTGATTTT
ATG
CTTGAGAATCTTCCTGAATGGGTTACTGCTAAACCAGTTAAGAAGAACGTGCTCACCATGCTGGATG
AG
GCCTATATTCAGCCACAGCCTCTGGGAGTGGTGCTGATAATCGGAGCTTGGAATTACCCCTTCGTTCT
C
ACCATTCAGCCACTGATAGGAGCCATCGCTGCAGGAAATGCTGTGATTATAAAGCCTTCTGAACTGAGT
GAA
AATACAGCCAAGATCTTGGCAAAGCTTCTCCCTCAGTATTTAGACCAGGATCTCTATATTGTTATTA
AT
GGTGGTGTTGAGGAAACCACGGAGCTCCTGAAGCAGCGATTTGACCACATTTTCTATACGGGAAACAC
T
GCGGTTGGCAAAATTGTCATGGAAGCTGCTGCCAAGCATCTGACCCCTGTGACTCTTGAACTGGGAGGG
AAA
AGTCCATGTTATATTGATAAAGATTGTGACCTGGACATTGTTTGCAGACGCATAACCTGGGGAAAAT
AC
ATGAATTGTGGCCAAACCTGCATTGCACCCGACTATATTCTCTGTGAAGCATCCCTCCAAAATCAAAT
T
GTATGGAAGATTAAGGAAACAGTGAAGGAATTTTATGGAGAAAATATAAAAGAGTCTCCTGATTATGAA
AGG
ATCATCAATCTTCGTCATTTTAAGAGGATACTAAGTTTGCTTGAAGGACAAAAGATAGCTTTTGGTG
GG
GAGACTGATGAGGCCACACGCTACATAGCCCCAACAGTACTTACCGATGTTGATCCTAAAACCAAGGT
G
ATGCAAGAAGAAATTTTTGGACCAATTCTTCCAATAGTGCCTGTGAAAAATGTAGATGAGGCCATAAAT
TTC
ATAAATGAACGTGAAAAGCCTCTGGCTCTTTATGTATTTTCGCATAACCATAAGCTCATCAAACGGA
TG
ATTGATGAGACATCCAGTGGAGGTGTCACAGGCAATGACGTCATTATGCACTTCACGCTCAACTCTTT
C
CCATTTGGAGGAGTGGGTTCCAGTGGGATGGGAGCTTATCACGGAAAACATAGTTTTGATACTTTTTCT
CAT
CAGCGTCCCTGTTTATTAAAAAGTTTAAAGAGAGAAGGTGCTAACAAACTCAGATATCCTCCCAACA
GC
CAGTCAAAGGTGGATTGGGGAAAATTTTTTCTCTTGAAACGGTTCAACAAAGAAAAACTCGGTCTCCT
G
TTGCTCACTTTCCTGGGTATTGTAGCCGCTGTGCTTGTCAAGGCAGAATATTACTGA


Translation (485 aa):
MELEVRRVRQAFLSGRSRPLRFRLQQLEALRRMVQEREKDILTAIAADLCKSEFNVYSQEVITVLGEIDF
M
LENLPEWVTAKPVKKNVLTMLDEAYIQPQPLGVVLIIGAWNYPFVLTIQPLIGAIAA
GNAVIIKPSELS
E
NTAKILAKLLPQYLDQ
DLYIVINGGVEETTELLKQRFDHIFYTGNTAVGKIVMEAAAKHLTPVTLELGG
K
SPCYIDKDCDLDIVC
RRITWGKYMNCGQTCIAPDYILCEASLQNQIVWKIKETVKEFYGENIKESPDYE
R
IINLRHFKRILSLLEGQKIAFGGETDEATRYI
APTVLTDVDPKTKVMQEEIFGPILPIVPVKNVDEAIN
F
INEREKPLALYVFSHNHK
LIKRMIDETSSGGVTGNDVIMHFTLNSFPFGGVGSSGMGAYHGKHSFDTFS
H
QRPCLLKSLKREGANKLRYPPNSQSKVDWGKFFLLKRFNKEKLGLLLLTFLGIVAAVLVK
AEYY



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser