NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS11200.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
11200.1 Public Homo sapiens 17 PRPSAP2 22 109 92 CCDS HistoryNCBI Gene:5636Re-query CCDS DB by CCDS ID:11200.1Re-query CCDS DB by GeneID:5636See the combined annotation on chromosome 17 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 11200.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000268835.6 ENSP00000268835.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000268835.6Link to Ensembl Protein Viewer:ENSP00000268835.2Re-query CCDS DB by Nucleotide ID:ENST00000268835Re-query CCDS DB by Protein ID:ENSP00000268835
Original member Current member NCBI NM_001353101.1 NP_001340030.1 Accepted alive Link to Nucleotide Sequence:NM_001353101.1Link to Protein Sequence:NP_001340030.1Re-query CCDS DB by Nucleotide ID:NM_001353101Re-query CCDS DB by Protein ID:NP_001340030Link to BLAST:NP_001340030.1
Original member Current member NCBI NM_001353102.1 NP_001340031.1 Accepted alive Link to Nucleotide Sequence:NM_001353102.1Link to Protein Sequence:NP_001340031.1Re-query CCDS DB by Nucleotide ID:NM_001353102Re-query CCDS DB by Protein ID:NP_001340031Link to BLAST:NP_001340031.1
Original member Current member NCBI NM_001353105.1 NP_001340034.1 Accepted alive Link to Nucleotide Sequence:NM_001353105.1Link to Protein Sequence:NP_001340034.1Re-query CCDS DB by Nucleotide ID:NM_001353105Re-query CCDS DB by Protein ID:NP_001340034Link to BLAST:NP_001340034.1
Original member Current member NCBI NM_001353106.1 NP_001340035.1 Accepted alive Link to Nucleotide Sequence:NM_001353106.1Link to Protein Sequence:NP_001340035.1Re-query CCDS DB by Nucleotide ID:NM_001353106Re-query CCDS DB by Protein ID:NP_001340035Link to BLAST:NP_001340035.1
Original member Current member NCBI NM_001353107.1 NP_001340036.1 Accepted alive Link to Nucleotide Sequence:NM_001353107.1Link to Protein Sequence:NP_001340036.1Re-query CCDS DB by Nucleotide ID:NM_001353107Re-query CCDS DB by Protein ID:NP_001340036Link to BLAST:NP_001340036.1
Original member NCBI NM_002767.3 NP_002758.1 Updated not alive Link to Nucleotide Sequence:NM_002767.3Link to Protein Sequence:NP_002758.1Re-query CCDS DB by Nucleotide ID:NM_002767Re-query CCDS DB by Protein ID:NP_002758
Current member NCBI NM_002767.4 NP_002758.1 Accepted alive Link to Nucleotide Sequence:NM_002767.4Link to Protein Sequence:NP_002758.1Re-query CCDS DB by Nucleotide ID:NM_002767Re-query CCDS DB by Protein ID:NP_002758Link to BLAST:NP_002758.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001340030.1 369 O60256-1 369 100% 0 0
NP_001340031.1 369 O60256-1 369 100% 0 0
NP_001340034.1 369 O60256-1 369 100% 0 0
NP_001340035.1 369 O60256-1 369 100% 0 0
NP_001340036.1 369 O60256-1 369 100% 0 0
NP_002758.1 369 O60256-1 369 100% 0 0

Chromosomal Locations for CCDS 11200.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 17 (NC_000017.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17See the combined annotation on chromosome 17 in Sequence Viewer

Chromosome Start Stop Links
17 18865834 18865952 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 18867282 18867334 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 18872583 18872649 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 18877698 18877870 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 18882568 18882683 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 18889822 18889877 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 18911103 18911251 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 18923914 18923984 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 18928811 18928957 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 18930540 18930698 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1110 nt):
ATGTTTTGTGTGACGCCACCTGAATTAGAAACCAAGATGAACATAACCAAAGGTGGTCTGGTGTTGTTTT
CA
GCAAACTCGAATTCATCATGTATGGAGCTATCAAAGAAAATTGCAGAGCGGCTAGGGGTGGAGATGGG
C
AAAGTGCAGGTTTACCAGGAACCTAACAGAGAAACAAGAGTACAAATTCAAGAGTCTGTGAGGGGAAAA
GAT
GTTTTCATCATCCAAACTGTTTCGAAGGACGTGAACACCACCATCATGGAGCTCCTGATCATGGTGT
AT
GCATGTAAGACCTCTTGTGCCAAGAGCATCATTGGCGTGATACCCTACTTTCCTTACAGCAAGCAGTG
C
AAGATGAGAAAAAGAGGCTCCATTGTCTCTAAATTGCTGGCTTCCATGATGTGCAAAGCTGGTCTAACT
CAT
CTTATTACTATGGATTTACACCAGAAGGAAATTCAGGGCTTCTTCAATATTCCTGTTGACAATTTAA
GA
GCATCTCCCTTCTTATTACAGTATATTCAAGAAGAGATCCCAGATTACAGGAATGCAGTAATCGTGGC
C
AAGTCTCCAGCCTCGGCGAAGAGGGCACAGTCTTTTGCTGAGCGCCTGCGCCTGGGAATTGCAGTGATT
CAT
GGAGAGGCGCAGGATGCCGAGTCGGACTTGGTGGATGGACGGCATTCCCCACCCATGGTCAGAAGTG
TG
GCTGCCATCCACCCCAGCCTGGAGATCCCCATGCTGATTCCTAAAGAAAAGCCCCCAATCACGGTTGT
G
GGTGATGTTGGAGGAAGGATTGCCATCATCGTGGATGACATCATTGATGATGTTGACAGCTTTCTTGCT
GCA
GCAGAGACCCTGAAGGAAAGAGGTGCATATAAGATCTTTGTGATGGCAACTCATGGCTTGTTGTCTT
CT
GACGCCCCCCGGCGGATTGAAGAGTCTGCCATTGATGAGGTGGTGGTCACCAATACAATTCCACATGA
A
GTCCAGAAGCTCCAGTGCCCCAAGATTAAAACTGTGGATATCAGCATGATCCTTTCAGAGGCGATCCGT
CGG
ATCCACAATGGGGAGTCCATGTCCTACCTTTTCAGAAACATAGGCTTAGATGACTGA


Translation (369 aa):
MFCVTPPELETKMNITKGGLVLFSANSNSSCMELSKKIAERLGVEMGKVQVYQEPNRETRVQIQESVRGK
D
VFIIQTVS
KDVNTTIMELLIMVYACKTSCAKSIIGVIPYFPYSKQCKMRKRGSIVSKLLASMMCKAGLT
H
LITMDLHQKEIQGFFNIPVDNLRASPFLLQYIQEE
IPDYRNAVIVAKSPASAKRAQSFAERLRLGIAVI
H
GEAQDAESDLVDGRHSPPMVRSVAAIHPSLEIP
MLIPKEKPPITVVGDVGGRIAIIVDDIIDDVDSFLA
A
AETLKERGAYKIFVMATHGLLSSDAPRRIEESAIDE
VVVTNTIPHEVQKLQCPKIKTVDISMILSEAIR
R
IHNGESMSYLFRNIGLDD




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser