NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS10995.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
10995.1 Public Homo sapiens 17 VPS53 24 110 108 CCDS HistoryNCBI Gene:55275Re-query CCDS DB by CCDS ID:10995.1Re-query CCDS DB by GeneID:55275See the combined annotation on chromosome 17 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 10995.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000291074.10 ENSP00000291074.5 Accepted alive Link to Ensembl Transcript Viewer:ENST00000291074.10Link to Ensembl Protein Viewer:ENSP00000291074.5Re-query CCDS DB by Nucleotide ID:ENST00000291074Re-query CCDS DB by Protein ID:ENSP00000291074
Original member Current member NCBI NM_018289.4 NP_060759.2 Accepted alive Link to Nucleotide Sequence:NM_018289.4Link to Protein Sequence:NP_060759.2Re-query CCDS DB by Nucleotide ID:NM_018289Re-query CCDS DB by Protein ID:NP_060759Link to BLAST:NP_060759.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_060759.2 670 Q5VIR6-2 670 100% 0 0

Chromosomal Locations for CCDS 10995.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 17 (NC_000017.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17See the combined annotation on chromosome 17 in Sequence Viewer

Chromosome Start Stop Links
17 532827 532911 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 537028 537176 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 551872 551950 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 553380 553462 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 560426 560573 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 562503 562745 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 586270 586364 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 601795 601896 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 623533 623674 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 627174 627316 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 628088 628231 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 631550 631628 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 653291 653410 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 655838 655953 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 697418 697484 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 699331 699380 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 710533 710613 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 714623 714709 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2013 nt):
ATGATGGAGGAGGAGGAACTGGAGTTCGTGGAGGAGCTGGAAGCCGTGCTGCAGCTCACGCCCGAGGTGC
AG
CTGGCCATCGAGCAGGTGTTTCCAAGCCAGGACCCTCTAGATCGAGCAGATTTCAATGCTGTTGAGTA
T
ATCAATACCCTGTTCCCAACCGAGCAATCTCTGGCGAACATAGACGAAGTCGTGAACAAAATTAGGCTG
AAA
ATAAGGAGACTGGATGACAATATTCGAACTGTTGTAAGAGGTCAGACGAACGTGGGGCAGGATGGAC
GG
CAAGTGAAAGAAATCACCCGTGATATTAAGCAATTAGATCACGCCAAACGCCACCTGACCACCTCAAT
C
ACCACACTGAACCACCTGCACATGCTGGCAGGAGGTGTCGACTCCCTCGAAGCCATGACCAGGCGAAGA
CAA
TACGGAGAAGTTGCTAATCTCCTTCAGGGTGTGATGAATGTCCTGGAGCACTTCCACAAGTATATGG
GG
ATTCCGCAGATCCGGCAGCTTTCCGAAAGAGTGAAGGCTGCACAGACTGAGTTAGGACAGCAAATCCT
G
GCAGATTTTGAAGAAGCGTTTCCTTCCCAGGGCACCAAGAGACCAGGAGGACCCAGCAATGTTCTACGA
GAT
GCATGTCTGGTTGCTAATATTCTAGATCCCAGGATCAAACAGGAAATCATCAAAAAGTTTATTAAAC
AG
CATCTGTCAGAGTATCTGGTACTTTTTCAAGAAAACCAAGATGTTGCCTGGCTGGACAAAATCGACAG
A
CGCTATGCCTGGATAAAACGCCAGCTTGTGGACTATGAGGAGAAATACGGCCGCATGTTTCCACGTGAG
TGG
TGCATGGCTGAGAGGATTGCGGTGGAATTTTGCCATGTGACAAGGGCAGAACTTGCCAAGATTATGC
GT
ACCAGAGCGAAGGAAATTGAAGTGAAATTGCTTCTTTTTGCTATTCAAAGAACAACTAACTTTGAGGG
G
TTTCTTGCAAAACGCTTCTCCGGCTGCACCCTGACCGATGGGACCCTGAAAAAGCTTGAGTCTCCACCC
CCA
TCTACCAATCCCTTCCTGGAAGATGAGCCAACACCAGAGATGGAGGAACTGGCAACGGAGAAAGGAG
AT
TTAGATCAACCAAAGAAGCCTAAAGCCCCAGACAATCCATTTCATGGCATTGTTTCCAAGTGTTTTGA
G
CCTCATCTCTACGTGTATATCGAATCCCAAGACAAGAACCTCGGAGAGCTGATAGATCGGTTTGTGGCT
GAT
TTCAAAGCCCAGGGGCCACCTAAGCCCAACACTGATGAAGGGGGTGCCGTGCTCCCCAGCTGCGCCG
AC
CTCTTTGTCTACTACAAGAAGTGCATGGTGCAATGCTCTCAGCTCAGTACTGGGGAGCCCATGATCGC
C
CTGACCACCATTTTCCAGAAGTACCTCCGAGAATACGCCTGGAAAATCCTCTCTGGCAACCTGCCCAAA
ACC
ACAACCAGCAGTGGAGGACTGACTATCAGCAGCCTCCTCAAGGAAAAGGAGGGCTCAGAAGTAGCCA
AG
TTCACTCTGGAGGAGCTCTGCCTCATCTGTAACATCCTGAGCACGGCAGAGTACTGTCTGGCCACCAC
C
CAGCAGCTAGAAGAAAAACTCAAAGAAAAAGTGGATGTAAGTCTGATTGAACGAATCAATCTGACTGGA
GAG
ATGGACACGTTCAGCACCGTCATCTCCAGCAGTATTCAGCTGCTGGTTCAGGATCTGGATGCTGCCT
GT
GATCCTGCCCTGACTGCCATGAGCAAGATGCAGTGGCAGAACGTGGAGCACGTTGGTGACCAGAGCCC
C
TACGTCACCTCTGTCATTCTGCACATCAAGCAGAACGTCCCCATCATCCGTGACAACCTGGCTTCCACA
CGC
AAGTACTTCACTCAGTTCTGCGTTAAATTTGCAAACTCCTTCATTCCCAAATTCATCACCCACCTCT
TC
AAGTGCAAGCCAATTAGCATGGTGGGAGCAGAACAGGTGAGATGGACGTAG


Translation (670 aa):
MMEEEELEFVEELEAVLQLTPEVQLAIEQVFPSQDPLDRADFNAVEYINTLFPTEQSLANIDEVVNKIRL
K
I
RRLDDNIRTVVRGQTNVGQDGRQVKEITRDIKQLDHAKRHLTTSITTLNHLHMLAGGVDSLEAMTRRR
Q
YGEVANLLQGVMNVLEHFHKYMGIPQIRQLSE
RVKAAQTELGQQILADFEEAFPSQGTKRPGGPSNVLR
D
ACLVANILDPRIKQEIIKKFIKQHLSEYLVLFQENQD
VAWLDKIDRRYAWIKRQLVDYEEKYGRMFPRE
W
CMAERIAVEFCHVT
RAELAKIMRTRAKEIEVKLLLFAIQRTTNFEGFLAKRFSGCTLTDGTLKKLESPP
P
STNPFLEDEPTPEMEELATEKGDLDQ
PKKPKAPDNPFHGIVSKCFEPHLYVYIESQDKNLGELIDRFVA
D
FKAQGPPKPNTDEGGAVLPSCADLFVYYKKCMVQCSQLSTGEPMIALTTIFQKYLREYAWKILSGNLP
K
T
TTSSGGLTISSLLKEKEGSEVAKFTLEELCLICNILSTAEYCLATTQQ
LEEKLKEKVDVSLIERINLTG
E
MDTFS
TVISSSIQLLVQDLDAACDPALTAMSKMQWQNVEHVGDQSPYVTSVILHIKQNVPIIRDNLAST
R
KYFTQFCVKFA
NSFIPKFITHLFKCKPISMVGAEQVRWT



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser