NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS10970.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
10970.1 Public Homo sapiens 16 GALNS 22 109 92 CCDS HistoryNCBI Gene:2588Re-query CCDS DB by CCDS ID:10970.1Re-query CCDS DB by GeneID:2588See the combined annotation on chromosome 16 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 10970.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000268695.9 ENSP00000268695.5 Accepted alive Link to Ensembl Transcript Viewer:ENST00000268695.9Link to Ensembl Protein Viewer:ENSP00000268695.5Re-query CCDS DB by Nucleotide ID:ENST00000268695Re-query CCDS DB by Protein ID:ENSP00000268695
Original member NCBI NM_000512.4 NP_000503.1 Updated not alive Link to Nucleotide Sequence:NM_000512.4Link to Protein Sequence:NP_000503.1Re-query CCDS DB by Nucleotide ID:NM_000512Re-query CCDS DB by Protein ID:NP_000503
Current member NCBI NM_000512.5 NP_000503.1 Accepted alive Link to Nucleotide Sequence:NM_000512.5Link to Protein Sequence:NP_000503.1Re-query CCDS DB by Nucleotide ID:NM_000512Re-query CCDS DB by Protein ID:NP_000503Link to BLAST:NP_000503.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_000503.1 522 P34059 522 100% 0 0

Chromosomal Locations for CCDS 10970.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 16 (NC_000016.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16See the combined annotation on chromosome 16 in Sequence Viewer

Chromosome Start Stop Links
16 88814439 88814525 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88818007 88818124 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88822589 88822710 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88824767 88824869 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88826702 88826838 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88831998 88832101 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88835213 88835352 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88835725 88835849 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88836201 88836267 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88837622 88837765 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88840992 88841094 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88841897 88841971 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88842706 88842829 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88856758 88856877 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1569 nt):
ATGGCGGCGGTTGTCGCGGCGACGAGGTGGTGGCAGCTGTTGCTGGTGCTCAGCGCCGCGGGGATGGGGG
CC
TCGGGCGCCCCGCAGCCCCCCAACATCCTGCTCCTGCTCATGGACGACATGGGATGGGGTGACCTCGG
G
GTGTATGGAGAGCCCTCCAGAGAGACCCCGAATTTGGACCGGATGGCTGCAGAAGGGCTGCTTTTCCCA
AAC
TTCTATTCTGCCAACCCTCTGTGCTCGCCATCGAGGGCGGCACTGCTCACAGGACGGCTACCCATCC
GC
AATGGCTTCTACACCACCAACGCCCATGCCAGAAACGCCTACACACCGCAGGAGATTGTGGGCGGCAT
C
CCAGACTCGGAGCAGCTCCTGCCGGAGCTTCTGAAGAAGGCCGGCTACGTCAGCAAGATTGTCGGCAAG
TG
G
CATCTGGGTCACAGGCCCCAGTTCCACCCCCTGAAGCACGGATTTGATGAGTGGTTTGGATCCCCCA
AC
TGCCACTTTGGACCTTATGACAACAAGGCCAGGCCCAACATCCCTGTGTACAGGGACTGGGAGATGGT
T
GGCAGATATTATGAAGAATTTCCTATTAATCTGAAGACGGGGGAAGCCAACCTCACCCAGATCTACCTG
CAG
GAAGCCCTGGACTTCATTAAGAGACAGGCACGGCACCACCCCTTTTTCCTCTACTGGGCTGTCGACG
CC
ACGCACGCACCCGTCTATGCCTCCAAACCCTTCTTGGGCACCAGTCAGCGAGGGCGGTATGGAGACGC
C
GTCCGGGAGATTGATGACAGCATTGGGAAGATACTGGAGCTCCTCCAAGACCTGCACGTCGCGGACAAC
ACC
TTCGTCTTCTTCACGTCGGACAACGGCGCTGCCCTCATTTCCGCCCCCGAACAAGGTGGCAGCAACG
GC
CCCTTTCTGTGTGGGAAGCAGACCACGTTTGAAGGAGGGATGAGGGAGCCTGCCCTCGCATGGTGGCC
A
GGGCACGTCACTGCAGGCCAGGTGAGCCACCAGCTGGGCAGCATCATGGACCTCTTCACCACCAGCCTG
GCC
CTTGCGGGCCTGACGCCGCCCAGCGACAGGGCCATTGATGGCCTCAACCTCCTCCCCACCCTCCTGC
AG
GGCCGGCTGATGGACAGGCCTATCTTCTATTACCGTGGCGACACGCTGATGGCGGCCACCCTCGGGCA
G
CACAAGGCTCACTTCTGGACCTGGACCAACTCCTGGGAGAACTTCAGACAGGGCATTGATTTCTGCCCT
GGG
CAGAACGTTTCAGGGGTCACAACTCACAATCTGGAAGACCACACGAAGCTGCCCCTGATCTTCCACC
TG
GGACGGGACCCAGGGGAGAGGTTCCCCCTCAGCTTTGCCAGCGCCGAGTACCAGGAGGCCCTCAGCAG
G
ATCACCTCGGTCGTCCAGCAGCACCAGGAGGCCTTGGTCCCCGCGCAGCCCCAGCTCAACGTGTGCAAC
TGG
GCGGTCATGAACTGGGCACCTCCGGGCTGTGAAAAGTTAGGGAAGTGTCTGACACCTCCAGAATCCA
TT
CCCAAGAAGTGCCTCTGGTCCCACTAG


Translation (522 aa):
MAAVVAATRWWQLLLVLSAAGMGASGAPQPPNILLLLMDDMGWGDLGVYGEPSRETPNLDRMAAEGLLFP
N
FYSANPLCSP
SRAALLTGRLPIRNGFYTTNAHARNAYTPQEIVGGIPDSEQLLPELLKKAGYVSKIVGK
W
HLGHRPQFHPLKHGFDEWFGSPNCHFGPYDNKARPNIPVYRDWEMVGRYYEEFPINLKTGEANLTQIYL
Q
EALDFIKRQARHHPFFLYWAVDATHAPVYASKPFLGTSQRGRYGDAVREIDDSIGKILELLQDLHVADN
T
FVFFTSDNGAALISAPEQ
GGSNGPFLCGKQTTFEGGMREPALAWWPGHVTAGQVSHQLGSIMDLFTTSL
A
LAGLTPPSDRAIDGLNLLPTLLQGRLMD
RPIFYYRGDTLMAATLGQHKAHFWTWTNSWENFRQGIDFCP
G
QNVSGVTTHNLEDHTKLPLIFHLGRDPGERFPL
SFASAEYQEALSRITSVVQQHQEALVPAQPQLNVCN
W
AVM
NWAPPGCEKLGKCLTPPESIPKKCLWSH



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser