NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS10968.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
10968.1 Public Homo sapiens 16 MVD 22 109 92 CCDS HistoryNCBI Gene:4597Re-query CCDS DB by CCDS ID:10968.1Re-query CCDS DB by GeneID:4597See the combined annotation on chromosome 16 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 10968.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000301012.7 ENSP00000301012.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000301012.7Link to Ensembl Protein Viewer:ENSP00000301012.3Re-query CCDS DB by Nucleotide ID:ENST00000301012Re-query CCDS DB by Protein ID:ENSP00000301012
Original member Current member NCBI NM_002461.2 NP_002452.1 Accepted alive Link to Nucleotide Sequence:NM_002461.2Link to Protein Sequence:NP_002452.1Re-query CCDS DB by Nucleotide ID:NM_002461Re-query CCDS DB by Protein ID:NP_002452Link to BLAST:NP_002452.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_002452.1 400 P53602 400 100% 0 0

Chromosomal Locations for CCDS 10968.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 16 (NC_000016.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16See the combined annotation on chromosome 16 in Sequence Viewer

Chromosome Start Stop Links
16 88652525 88652605 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88653300 88653408 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88654692 88654807 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88655199 88655417 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88655656 88655730 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88656105 88656304 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88657436 88657582 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88657915 88658029 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88658650 88658720 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 88663011 88663080 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1203 nt):
ATGGCCTCGGAGAAGCCGCTGGCGGCAGTCACTTGTACAGCGCCGGTCAACATCGCGGTCATCAAGTACT
GG
GGCAAGCGCGATGAAGAGCTGGTTCTGCCCATCAACTCCTCCCTGAGCGTCACTCTGCACCAGGACCA
G
TTAAAAACCACCACAACAGCCGTCATCAGCAAGGACTTCACCGAGGACCGGATTTGGCTGAATGGCCGG
GAG
GAGGATGTGGGGCAGCCGCGGCTGCAGGCCTGCCTGCGGGAGATCCGCTGCCTGGCCCGGAAGCGGA
GG
AACTCACGGGATGGGGACCCGCTGCCCTCCAGCCTCAGCTGCAAGGTGCACGTGGCATCGGTGAACAA
C
TTCCCCACGGCTGCGGGCCTGGCCTCCTCAGCGGCGGGCTATGCCTGCCTAGCCTACACCCTGGCCCGT
GTC
TACGGCGTGGAGAGTGACCTCTCAGAAGTGGCTCGCCGGGGCTCAGGCAGCGCCTGCCGGAGCCTGT
AT
GGGGGCTTTGTGGAGTGGCAGATGGGAGAGCAGGCCGACGGGAAGGACAGCATCGCTCGGCAAGTGGC
C
CCCGAGTCACACTGGCCTGAACTCCGCGTGCTCATCCTTGTGGTGAGCGCTGAGAAGAAGCTGACAGGC
AGT
ACCGTGGGCATGCGGGCCAGTGTGGAGACCAGCCCCCTGCTTCGGTTCCGGGCCGAGTCCGTGGTGC
CC
GCGCGCATGGCGGAGATGGCCCGCTGCATCCGGGAGCGAGACTTCCCCAGCTTCGCCCAGCTGACCAT
G
AAGGACAGCAACCAGTTCCACGCCACCTGCCTCGACACCTTCCCGCCCATCTCTTACCTCAATGCCATC
TCC
TGGCGCATCATCCACCTGGTGCACCGCTTCAACGCCCACCACGGGGACACCAAGGTGGCGTACACCT
TT
GACGCGGGCCCCAATGCCGTGATCTTCACCCTGGACGACACTGTGGCTGAGTTTGTGGCTGCTGTGTG
G
CACGGCTTTCCCCCAGGCTCGAATGGAGACACGTTTCTGAAGGGGCTGCAGGTGAGGCCGGCCCCTCTC
TCA
GCTGAGCTTCAGGCTGCGCTGGCCATGGAGCCGACCCCCGGTGGGGTCAAATACATCATTGTCACTC
AG
GTGGGGCCAGGGCCTCAAATCCTGGATGACCCCTGCGCCCACCTCCTGGGTCCTGACGGCCTGCCGAA
G
CCAGCTGCCTGA


Translation (400 aa):
MASEKPLAAVTCTAPVNIAVIKYWGKRDEELVLPINSSLSVTLHQDQLKTTTTAVISKDFTEDRIWLNGR
E
EDVGQPRLQACLRE
IRCLARKRRNSRDGDPLPSSLSCKVHVASVNNFPTAAGLASSAAGYACLAYTLAR
V
YGVESDLSEVARRGSGSACRSLYGGFVEWQMGEQADGKDSIARQVAPESHWPELRVLILV
VSAEKKLTG
S
TVGMRASVETSPLLR
FRAESVVPARMAEMARCIRERDFPSFAQLTMKDSNQFHATCLDTFPPISYLNAI
S
WRIIHLVHRFNAHHGDTK
VAYTFDAGPNAVIFTLDDTVAEFVAAVWHGFPPGSNGDTFLKGLQVRPAPL
S
AELQAALAMEPTPGGVKYIIVTQ
VGPGPQILDDPCAHLLGPDGLPKPAA



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser