NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS10855.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
10855.1 Public Homo sapiens 16 SLC12A4 22 109 92 CCDS HistoryNCBI Gene:6560Re-query CCDS DB by CCDS ID:10855.1Re-query CCDS DB by GeneID:6560See the combined annotation on chromosome 16 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 10855.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000316341.7 ENSP00000318557.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000316341.7Link to Ensembl Protein Viewer:ENSP00000318557.3Re-query CCDS DB by Nucleotide ID:ENST00000316341Re-query CCDS DB by Protein ID:ENSP00000318557
Original member NCBI NM_005072.4 NP_005063.1 Updated not alive Link to Nucleotide Sequence:NM_005072.4Link to Protein Sequence:NP_005063.1Re-query CCDS DB by Nucleotide ID:NM_005072Re-query CCDS DB by Protein ID:NP_005063
Current member NCBI NM_005072.5 NP_005063.1 Accepted alive Link to Nucleotide Sequence:NM_005072.5Link to Protein Sequence:NP_005063.1Re-query CCDS DB by Nucleotide ID:NM_005072Re-query CCDS DB by Protein ID:NP_005063Link to BLAST:NP_005063.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_005063.1 1085 Q9UP95-1 1085 100% 0 0

Chromosomal Locations for CCDS 10855.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 16 (NC_000016.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16See the combined annotation on chromosome 16 in Sequence Viewer

Chromosome Start Stop Links
16 67944840 67944931 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 67945087 67945220 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 67945369 67945553 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 67945764 67945871 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 67945951 67946082 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 67946171 67946340 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 67946438 67946633 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 67946937 67947105 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 67947331 67947435 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 67947669 67947788 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 67948061 67948159 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 67949800 67949918 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 67950319 67950493 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 67950654 67950711 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 67950962 67951060 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 67951140 67951304 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 67951823 67952037 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 67952184 67952425 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 67954643 67954773 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 67957742 67957796 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 67957898 67958044 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 67961575 67961706 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 67963465 67963559 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 67968439 67968553 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3258 nt):
ATGCCTCACTTCACCGTGGTGCCAGTGGACGGGCCGAGGCGCGGCGACTATGACAACCTCGAGGGGCTCA
GT
TGGGTGGACTACGGGGAGCGCGCCGAGCTGGATGACTCGGACGGACATGGCAACCACAGAGAGAGCAG
C
CCTTTTCTTTCCCCCTTGGAGGCTTCCAGAGGAATTGACTACTATGACAGGAACCTGGCACTGTTTGAG
GAA
GAGCTGGACATCCGCCCAAAGGTATCGTCTCTTCTGGGAAAGCTCGTCAGCTACACCAACCTCACCC
AG
GGCGCCAAAGAGCATGAGGAGGCCGAGAGTGGGGAGGGCACCCGCCGGAGGGCAGCCGAGGCACCCAG
C
ATGGGCACCCTCATGGGGGTGTACCTGCCCTGCCTGCAGAATATCTTTGGGGTTATCCTCTTCCTGCGG
CTG
ACCTGGATGGTGGGCACAGCAGGTGTGCTACAGGCCCTCCTCATCGTGCTTATCTGCTGCTGTTGTA
CC
CTGCTGACGGCCATCTCCATGAGTGCCATCGCCACCAACGGTGTGGTTCCAGCTGGGGGCTCCTATTT
C
ATGATCTCTCGTTCACTGGGGCCAGAATTTGGAGGTGCTGTGGGCCTGTGCTTCTACCTGGGAACAACA
TTC
GCAGCAGCCATGTACATCCTGGGGGCCATCGAGATCTTGCTGACCTACATTGCCCCACCAGCTGCCA
TT
TTTTACCCATCGGGTGCTCATGACACGTCGAATGCCACTTTGAACAATATGCGTGTGTATGGGACCAT
T
TTCCTGACCTTCATGACCCTGGTGGTGTTTGTGGGGGTCAAGTATGTGAACAAATTTGCCTCGCTCTTC
CTG
GCCTGTGTGATCATCTCCATCCTCTCCATCTATGCTGGGGGCATAAAGTCTATATTTGACCCTCCCG
TG
TTTCCGGTATGCATGCTGGGCAACAGGACCCTGTCCCGGGACCAGTTTGACATCTGTGCCAAGACAGC
T
GTAGTGGACAATGAGACAGTGGCCACCCAGCTATGGAGTTTCTTCTGCCACAGCCCCAACCTTACGACC
GAC
TCCTGTGACCCCTACTTCATGCTCAACAATGTGACCGAGATCCCTGGCATCCCCGGGGCAGCTGCTG
GT
GTGCTCCAGGAAAACCTGTGGAGCGCCTACCTGGAGAAGGGTGACATCGTGGAGAAGCATGGGCTGCC
C
TCCGCAGATGCCCCGAGCCTGAAGGAGAGCCTGCCTCTGTACGTGGTCGCTGACATCGCCACATCCTTC
ACC
GTGCTGGTCGGCATCTTCTTCCCTTCTGTAACAGGCATCATGGCTGGCTCAAACCGCTCTGGGGACC
TT
CGTGACGCCCAGAAGTCTATCCCTGTGGGGACCATTCTGGCCATCATTACAACTTCCCTCGTGTACTT
C
AGCAGTGTGGTTCTCTTTGGTGCCTGCATTGAGGGTGTGGTTCTCCGGGACAAGTATGGCGATGGTGTC
AGC
AGGAACTTGGTGGTGGGCACACTGGCCTGGCCTTCACCCTGGGTCATCGTCATCGGCTCCTTCTTTT
CA
ACGTGTGGCGCTGGCCTCCAGAGCCTCACAGGGGCACCACGCCTATTGCAGGCCATTGCCAAGGACAA
C
ATCATCCCCTTCCTCCGGGTGTTTGGCCACGGGAAGGTGAATGGTGAACCCACATGGGCACTCCTCCTG
ACG
GCACTCATCGCCGAGCTGGGCATCCTCATCGCCTCCCTCGACATGGTGGCCCCCATCTTATCCATGT
TC
TTTCTGATGTGCTACCTGTTCGTGAACCTCGCCTGTGCGGTGCAGACACTCCTGAGGACCCCCAACTG
G
CGGCCCCGGTTCAAGTACTATCACTGGGCGCTGTCCTTCCTGGGCATGAGTCTCTGCCTGGCCCTTATG
TTT
GTCTCCTCCTGGTACTATGCCCTGGTGGCCATGCTCATCGCCGGCATGATCTACAAATACATCGAGT
AC
CAAGGGGCTGAGAAGGAGTGGGGTGACGGGATCCGAGGCCTGTCCCTGAGCGCTGCCCGCTACGCGCT
G
TTGCGGCTGGAGGAGGGGCCTCCTCACACCAAGAACTGGCGGCCGCAGCTGCTGGTGCTGCTGAAGCTG
GAC
GAGGACCTCCACGTGAAGTACCCGCGGCTCCTCACCTTCGCCTCCCAGCTCAAGGCTGGCAAGGGCC
TG
ACCATTGTTGGTTCTGTCATCCAGGGGAGCTTCTTGGAGAGCTATGGCGAGGCTCAGGCCGCCGAGCA
G
ACCATCAAGAACATGATGGAAATTGAGAAGGTGAAGGGCTTCTGCCAGGTGGTGGTGGCCAGCAAGGTG
CGG
GAGGGGCTGGCCCACCTCATCCAGTCCTGTGGCCTGGGAGGCATGCGGCATAACTCCGTGGTGCTGG
GC
TGGCCCTACGGCTGGCGACAGAGCGAGGACCCCCGTGCCTGGAAGACCTTCATTGACACCGTGCGCTG
C
ACTACGGCTGCCCACCTGGCCCTGCTCGTGCCCAAGAACATCGCCTTCTACCCCAGCAACCACGAGCGC
TAC
CTGGAGGGCCACATAGACGTGTGGTGGATCGTGCACGATGGTGGCATGCTCATGCTTCTGCCCTTCC
TG
CTGCGCCAGCATAAGGTCTGGAGGAAGTGCCGGATGCGCATCTTCACAGTGGCCCAGATGGATGACAA
C
AGCATCCAGATGAAGAAGGACCTGGCTGTCTTTCTGTACCATCTGCGCCTTGAGGCCGAGGTGGAGGTG
GTG
GAGATGCATAACAGTGACATCTCTGCATACACCTACGAGCGGACGCTGATGATGGAGCAGCGGTCGC
AG
ATGCTGCGGCAGATGAGACTGACCAAGACTGAGCGGGAGCGAGAAGCCCAGCTGGTCAAGGATCGGCA
C
TCGGCCCTGCGGCTGGAGAGCCTGTACTCGGACGAGGAAGATGAGTCTGCAGTGGGGGCTGACAAGATC
CAG
ATGACGTGGACCAGGGACAAGTACATGACTGAGACCTGGGACCCCAGCCATGCCCCTGACAATTTCC
GG
GAGCTGGTGCACATTAAGCCGGACCAATCCAATGTGCGGCGCATGCACACTGCTGTGAAGCTCAATGA
A
GTCATTGTCACGCGCTCCCACGACGCCCGCCTGGTTCTCCTAAACATGCCTGGCCCACCCAGGAACAGT
GAG
GGCGACGAGAACTACATGGAGTTCCTCGAGGTGCTGACCGAGGGCCTTGAGCGGGTGCTGTTGGTGC
GC
GGTGGTGGCCGTGAAGTCATCACCATCTACTCCTGA


Translation (1085 aa):
MPHFTVVPVDGPRRGDYDNLEGLSWVDYGERAELDDSDGHGNHRESSPFLSPLEASRGIDYYDRNLALFE
E
ELDIRPKVSSLLGKLVSYTNLTQGAKEHEEAESGEGTRRRAAE
APSMGTLMGVYLPCLQNIFGVILFLR
L
TWMVGTAGVLQALLIVLICCCC
TLLTAISMSAIATNGVVPAGGSYFMISRSLGPEFGGAVGLCFYLGTT
F
AAAMYILGAIEILL
TYIAPPAAIFYPSGAHDTSNATLNNMRVYGTIFLTFMTLVVFVGVKYVNKFASLF
L
ACVIISILSIYAGGIKSIFDPPVF
PVCMLGNRTLSRDQFDICAKTAVVDNETVATQLWSFFCHSPNLTT
D
SCDPYFMLNNVTEIPGIPGAAAGVLQ
ENLWSAYLEKGDIVEKHGLPSADAPSLKESLPLYVVADIATSF
T
VLVGIFFPSVT
GIMAGSNRSGDLRDAQKSIPVGTILAIITTSLVYFSSVVLFGACIEGVVLRDKYGDGV
S
RNLVVGTLAWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKDNIIPFLR
VFGHGKVNGEPTWALLL
T
ALIAELGILIASLDMVAPILS
MFFLMCYLFVNLACAVQTLLRTPNWRPRFKYYHWALSFLGMSLCLALM
F
VSSWYYALVAMLIAGMIYKYIEYQ
GAEKEWGDGIRGLSLSAARYALLRLEEGPPHTKNWRPQLLVLLKL
D
EDLHVKYPRLLTFASQLKAGKGLTIVGSVIQGSFLESYGEAQAAEQ
TIKNMMEIEKVKGFCQVVVASKV
R
EGLAHLIQSCGLGGMRHNSVVLGWPYGWRQSEDPRAWKTFI
DTVRCTTAAHLALLVPKNIAFYPSNHER
Y
LEGHIDVWWIVHDGGMLMLLPFLLRQHK
VWRKCRMRIFTVAQMDDNSIQMKKDLAVFLYHLRLEAEVEV
V
EM
HNSDISAYTYERTLMMEQRSQMLRQMRLTKTEREREAQLVKDRHSALRLESLYSDEEDESAVGADKI
Q
MTWTRDKYMTETWDPSHAPDNFRELVHIK
PDQSNVRRMHTAVKLNEVIVTRSHDARLVLLNMPGPPRNS
E
GDEN
YMEFLEVLTEGLERVLLVRGGGREVITIYS



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser