NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS10842.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
10842.1 Reviewed, update pending Homo sapiens 16 ACD 22 109 92 CCDS HistoryNCBI Gene:65057Re-query CCDS DB by CCDS ID:10842.1Re-query CCDS DB by GeneID:65057See the combined annotation on chromosome 16 in Sequence Viewer

Public Note for CCDS 10842.1
This CCDS was updated to trim the coding region at the 5' end, which shortens the N-terminus of the protein by 86 amino acid residues. The update is supported by conservation data.

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)

Sequence IDs included in CCDS 10842.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000219251.12 ENSP00000219251.7 Accepted alive Link to Ensembl Transcript Viewer:ENST00000219251.12Link to Ensembl Protein Viewer:ENSP00000219251.7Re-query CCDS DB by Nucleotide ID:ENST00000219251Re-query CCDS DB by Protein ID:ENSP00000219251
Original member NCBI NM_022914.2 NP_075065.2 Updated not alive Link to Nucleotide Sequence:NM_022914.2Link to Protein Sequence:NP_075065.2Re-query CCDS DB by Nucleotide ID:NM_022914Re-query CCDS DB by Protein ID:NP_075065
Current member NCBI NM_022914.3 NP_075065.3 Pending alive Link to Nucleotide Sequence:NM_022914.3Link to Protein Sequence:NP_075065.3Re-query CCDS DB by Nucleotide ID:NM_022914Re-query CCDS DB by Protein ID:NP_075065Link to BLAST:NP_075065.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_075065.3 455 Q96AP0-2 455 100% 0 0

Chromosomal Locations for CCDS 10842.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 16 (NC_000016.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16See the combined annotation on chromosome 16 in Sequence Viewer

Chromosome Start Stop Links
16 67657606 67657684 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 67657762 67657853 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 67657986 67658362 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 67658555 67658641 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 67658720 67658816 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 67658928 67659079 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 67659229 67659263 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 67659375 67659419 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 67659537 67659613 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 67659702 67659795 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 67659903 67660036 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 67660122 67660478 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1626 nt):
ATGCCTGGCCGCTGTCAGAGTGACGCCGCGATGAGAGTAAACGGGCCAGCATCCCGTGCACCAGCGGGGT
GG
ACCAGCGGGAGTCTGCACACAGGCCCCCGAGCAGGACGCCCTCGTGCGCAGGCGCGGGGTGTACGTGG
G
CGGGGCCTCCTCCTCCGGCCCCGCCCAGCGAAGGAGCTTCCTCTTCCGAGGAAAGGCGGGGCCTGGGCG
CCC
GCGGGAAACCCGGGCCCGTTGCATCCGCTGGGTGTAGCCGTGGGGATGGCAGGTTCGGGGAGGCTGG
TC
CTACGGCCCTGGATTCGGGAGCTGATTCTGGGGTCAGAGACACCCTCCAGTCCACGAGCCGGGCAGCT
G
CTTGAGGACGCCGAGGCCGCGGTCGCGGGCCCATCCCACGCCCCTGATACGTCCGACGTCGGGGCCACG
CTG
CTTGTGTCTGACGGGACCCACAGTGTCCGATGCCTGGTGACGCGGGAGGCCCTGGACACCTCGGACT
G
G
GAGGAGAAGGAGTTCGGCTTCCGCGGGACAGAGGGCCGGCTGCTGCTGCTGCAGGACTGCGGGGTTCA
T
GTCCAGGTCGCTGAGGGCGGCGCGCCCGCAGAGTTCTATCTCCAGGTGGACCGCTTCAGCCTGCTGCCC
ACG
GAGCAGCCCCGGCTACGGGTGCCTGGTTGCAACCAAGACTTAGATGTTCAGAAAAAGCTCTATGACT
GC
CTTGAGGAGCACCTTTCAGAGTCCACCTCGTCCAATGCAGGCCTATCACTGTCCCAGCTTCTGGATGA
A
ATGCGGGAGGACCAGGAGCATCAGGGGGCACTCGTGTGCCTGGCTGAAAGCTGCCTGACACTGGAGGGC
CCT
TGCACAGCACCCCCTGTCACCCACTGGGCTGCCTCACGATGCAAGGCCACGGGAGAAGCTGTGTACA
CT
GTCCCCAGCTCAATGCTGTGCATCTCTGAGAATGACCAGCTAATTCTGAGCTCTCTAGGCCCCTGTCA
G
AGGACACAGGGCCCTGAGCTGCCCCCACCAGACCCGGCTCTGCAGGACCTATCTCTGACCCTCATAGCC
TCT
CCTCCTTCCTCACCCAGTTCCTCAGGAACCCCGGCCTTACCCGGCCACATGTCATCCGAGGAAAGTG
GT
ACCAGCATCAGCCTTCTGCCTGCCCTGTCCTTGGCTGCTCCAGACCCAGGGCAGAGAAGCAGCTCCCA
G
CCCTCACCAGCCATCTGCTCAGCCCCTGCCACCCTGACCCCCAGGTCCCCACACGCCAGCCGTACCCCC
AGC
TCCCCACTCCAGAGCTGCACTCCCAGTCTCTCACCCCGTAGCCATGTCCCCAGTCCACACCAGGCTC
TT
GTGACCAGGCCCCAGAAACCTAGCCTGGAGTTCAAGGAGTTTGTAGGGTTGCCCTGCAAGAATCGGCC
G
CCTTTTCCCAGGACCGGAGCTACCAGGGGAGCCCAGGAGCCCTGCTCTGTCTGGGAACCCCCAAAGAGG
CAT
CGTGATGGTTCTGCCTTCCAGTATGAGTATGAGCCACCCTGCACGTCCCTCTGTGCTCGGGTCCAAG
CT
GTCAGGCTTCCTCCCCAGCTCATGGCCTGGGCCTTGCACTTTCTGATGGATGCACAGCCAGGGTCTGA
G
CCAACTCCGATGTGA


Translation (541 aa):
MPGRCQSDAAMRVNGPASRAPAGWTSGSLHTGPRAGRPRAQARGVRGRGLLLRPRPAKELPLPRKGGAWA
P
AGNPGPLHPLGVAVGMAGSGRLVLRPWIRELILGSETPSSPRAGQLLE
DAEAAVAGPSHAPDTSDVGAT
L
LVSDGTHSVRCLVTREALDTSD
WEEKEFGFRGTEGRLLLLQDCGVHVQVAEGGAPAEFYLQVDRFSLLP
T
EQPRLRVPG
CNQDLDVQKKLYDCLEEHLSESTSSNAGLSLSQLLDEMREDQEHQGALVCLAESCLTLEG
P
CTAPPVTHWAASRCKAT
GEAVYTVPSSMLCISENDQLILSSLGPCQRTQGPELPPPDPALQDLSLTLIA
S
PPSSPSSS
GTPALPGHMSSEESGTSISLLPALSLAAPDPGQRSSSQPSPAICSAPATLTPRSPHASRTP
S
SPLQSCTPSLSPRSHVPSPHQALVTRPQKPSLEFKEFVGLPCKNRPPFPRTGATRGAQEPCSVW
EPPKR
H
RDGSAFQYEYEPPCTSLCARVQAV
RLPPQLMAWALHFLMDAQPGSEPTPM



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser