NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS10666.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
10666.1 Public Homo sapiens 16 DOC2A 22 109 92 CCDS HistoryNCBI Gene:8448Re-query CCDS DB by CCDS ID:10666.1Re-query CCDS DB by GeneID:8448See the combined annotation on chromosome 16 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 10666.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000350119.8 ENSP00000340017.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000350119.8Link to Ensembl Protein Viewer:ENSP00000340017.4Re-query CCDS DB by Nucleotide ID:ENST00000350119Re-query CCDS DB by Protein ID:ENSP00000340017
Original member Current member EBI,WTSI ENST00000564944.5 ENSP00000455196.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000564944.5Link to Ensembl Protein Viewer:ENSP00000455196.1Re-query CCDS DB by Nucleotide ID:ENST00000564944Re-query CCDS DB by Protein ID:ENSP00000455196
Original member Current member EBI,WTSI ENST00000564979.5 ENSP00000455624.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000564979.5Link to Ensembl Protein Viewer:ENSP00000455624.1Re-query CCDS DB by Nucleotide ID:ENST00000564979Re-query CCDS DB by Protein ID:ENSP00000455624
Original member Current member EBI,WTSI ENST00000616445.4 ENSP00000482870.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000616445.4Link to Ensembl Protein Viewer:ENSP00000482870.1Re-query CCDS DB by Nucleotide ID:ENST00000616445Re-query CCDS DB by Protein ID:ENSP00000482870
Original member Current member NCBI NM_001282062.1 NP_001268991.1 Accepted alive Link to Nucleotide Sequence:NM_001282062.1Link to Protein Sequence:NP_001268991.1Re-query CCDS DB by Nucleotide ID:NM_001282062Re-query CCDS DB by Protein ID:NP_001268991Link to BLAST:NP_001268991.1
Original member Current member NCBI NM_001282063.1 NP_001268992.1 Accepted alive Link to Nucleotide Sequence:NM_001282063.1Link to Protein Sequence:NP_001268992.1Re-query CCDS DB by Nucleotide ID:NM_001282063Re-query CCDS DB by Protein ID:NP_001268992Link to BLAST:NP_001268992.1
Original member NCBI NM_001282068.1 NP_001268997.1 Updated not alive Link to Nucleotide Sequence:NM_001282068.1Link to Protein Sequence:NP_001268997.1Re-query CCDS DB by Nucleotide ID:NM_001282068Re-query CCDS DB by Protein ID:NP_001268997
Current member NCBI NM_001282068.2 NP_001268997.1 Accepted alive Link to Nucleotide Sequence:NM_001282068.2Link to Protein Sequence:NP_001268997.1Re-query CCDS DB by Nucleotide ID:NM_001282068Re-query CCDS DB by Protein ID:NP_001268997Link to BLAST:NP_001268997.1
Original member NCBI NM_003586.2 NP_003577.2 Updated not alive Link to Nucleotide Sequence:NM_003586.2Link to Protein Sequence:NP_003577.2Re-query CCDS DB by Nucleotide ID:NM_003586Re-query CCDS DB by Protein ID:NP_003577
Current member NCBI NM_003586.3 NP_003577.2 Accepted alive Link to Nucleotide Sequence:NM_003586.3Link to Protein Sequence:NP_003577.2Re-query CCDS DB by Nucleotide ID:NM_003586Re-query CCDS DB by Protein ID:NP_003577Link to BLAST:NP_003577.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001268991.1 400 Q14183-1 400 100% 0 0
NP_001268992.1 400 Q14183-1 400 100% 0 0
NP_001268997.1 400 Q14183-1 400 100% 0 0
NP_003577.2 400 Q14183-1 400 100% 0 0

Chromosomal Locations for CCDS 10666.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 16 (NC_000016.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16See the combined annotation on chromosome 16 in Sequence Viewer

Chromosome Start Stop Links
16 30006186 30006331 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 30006413 30006509 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 30006596 30006677 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 30006785 30006948 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 30007031 30007090 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 30007173 30007299 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 30008996 30009105 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 30009202 30009276 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 30009478 30009557 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 30009961 30010222 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1203 nt):
ATGAGGGGCCGCAGGGGCGATCGCATGACCATCAACATCCAGGAGCACATGGCCATCAACGTGTGCCCCG
GG
CCCATCCGGCCCATCCGCCAGATCTCTGACTACTTCCCCCGGGGACCAGGACCTGAAGGGGGCGGCGG
G
GGCGGCGGGGAGGCCCCCGCCCATCTGGTCCCCCTGGCTCTGGCCCCCCCTGCAGCCCTCCTTGGGGCC
ACC
ACGCCTGAGGATGGTGCGGAGGTGGACAGCTATGACTCGGATGATGCCACCGCCCTAGGCACGCTGG
AG
TTTGACCTTCTCTACGACCGGGCCTCCTGCACTCTGCACTGTAGCATCCTCAGGGCCAAGGGCCTCAA
G
CCCATGGATTTCAATGGCCTCGCCGACCCCTACGTCAAGCTGCACTTGCTGCCTGGAGCCTGTAAGGCC
AAT
AAGCTAAAAACGAAGACTCAGAGGAACACACTGAATCCCGTGTGGAATGAGGACCTGACTTACAGCG
GG
ATCACAGATGACGACATCACGCACAAGGTGCTCAGGATCGCCGTCTGTGATGAGGACAAGCTGAGTCA
C
AATGAGTTTATTGGGGAGATCCGCGTGCCCCTCCGCCGCCTCAAGCCTTCGCAGAAGAAGCATTTTAAC
ATC
TGCCTCGAGCGCCAGGTCCCGCTGGCGTCCCCCTCTTCCATGTCAGCGGCGCTGAGGGGCATCTCCT
GT
TATCTGAAGGAGTTGGAGCAGGCGGAGCAGGGGCAGGGGCTGCTGGAGGAGCGTGGCCGCATCCTGCT
G
AGTCTCAGCTACAGCTCGCGGCGCCGGGGACTGCTGGTAGGCATCTTGCGCTGCGCCCATCTGGCTGCC
ATG
GACGTCAACGGTTACTCGGACCCCTACGTCAAGACGTACCTGAGGCCCGATGTGGACAAGAAATCCA
AG
CATAAGACGTGTGTGAAGAAGAAGACTCTCAACCCAGAATTTAACGAGGAGTTTTTCTACGAGATAGA
G
CTCTCCACTCTGGCCACCAAGACCCTGGAAGTCACCGTCTGGGACTATGACATTGGCAAATCCAATGAC
TTC
ATTGGTGGCGTGTCCCTGGGGCCAGGTGCCCGAGGCGAGGCTCGGAAGCACTGGAGTGACTGCCTGC
AG
CAGCCGGACGCAGCCCTGGAGCGCTGGCACACCCTGACCAGTGAGCTGCCCCCTGCGGCCGGGGCTCT
G
TCCTCAGCCTGA


Translation (400 aa):
MRGRRGDRMTINIQEHMAINVCPGPIRPIRQISDYFPRGPGPEGGGGGGGEAPAHLVPLALAPPAALLGA
T
TPEDGAEVDSYDSDDA
TALGTLEFDLLYDRASCTLHCSILRAKGLKPMDFNGLADPYVKLHLLPGACKA
N
KLKTKTQRNTLNPVWNEDLTYSGITDDDITHKVL
RIAVCDEDKLSHNEFIGEIRVPLRRLKPSQKKHFN
I
CLERQVP
LASPSSMSAALRGISCYLKELEQAEQGQGLLEERGRILLSLSYSSRRRGLLVGILRCAHLAA
M
DVNGYSDPYVK
TYLRPDVDKKSKHKTCVKKKTLNPEFNEEFFYEIELSTLATKTLEVTVWDYDIGKSND
F
I
GGVSLGPGARGEARKHWSDCLQQPDAALERWHTLTSELPPAAGALSSA



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser